SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H6MAS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H6MAS1
Domain Number 1 Region: 8-97,125-187
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000661
Family Atu1826-like 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H6MAS1
Sequence length 215
Comment (tr|A0A1H6MAS1|A0A1H6MAS1_9BACT) Alpha/beta hydrolase fold {ECO:0000313|EMBL:SEH98555.1} KW=Complete proteome OX=1679444 OS=Akkermansia glycaniphila. GN=PYTT_2308 OC=Akkermansiaceae; Akkermansia.
Sequence
MQQHWLNRSNSGKLIIYALGWASTPDAVAHIHTPDYDILCLYDYRSISPLTPEDFSGYSH
ITLFAWSFGVWVSERIASGLPLARAIALNGTPLPVSDEYGMRLRVVLRTMQGLKRVGMAP
FNEKTYGGLENMPALQYPDRSIDEKIDELNYLAEQAKADSTPIIPWDKAYIADQDEIFPP
AKMEAYWHSRGLGTPFHAYHYPFADPAIVLNELPE
Download sequence
Identical sequences A0A1H6MAS1
WP_067775878.1.32440 WP_067775878.1.84687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]