SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H6MM72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H6MM72
Domain Number 1 Region: 30-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.01e-18
Family Glutathione peroxidase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H6MM72
Sequence length 178
Comment (tr|A0A1H6MM72|A0A1H6MM72_PRERU) Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family {ECO:0000313|EMBL:SEI02883.1} KW=Complete proteome OX=839 OS=Prevotella ruminicola (Bacteroides ruminicola). GN=SAMN02745192_3030 OC=Prevotella.
Sequence
MLAALLMTACGGCSATDDKVDGDEVMDADSLVVGDQLPAFEVTMNDGSVVRTADLKGQPS
VVVLFSVDCPDCRHELPEVQKLWDRSRQGELTGDGKPLPIVLIARKNLTEDIEPFWKFAE
LTMPYSPQPDRKVYSRFAPSRIPRIYISDASATIRVAYADTGMPTAETLAEEISRLNE
Download sequence
Identical sequences A0A1H6MM72 D5EXQ2
gi|294673269|ref|YP_003573885.1| WP_013065363.1.33358 WP_013065363.1.49956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]