SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H6UB97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H6UB97
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.27e-41
Family SMI1/KNR4-like 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H6UB97
Sequence length 135
Comment (tr|A0A1H6UB97|A0A1H6UB97_PSEOL) SMI1-KNR4 cell-wall {ECO:0000313|EMBL:SEI89581.1} KW=Complete proteome OX=301 OS=Pseudomonas oleovorans. GN=SAMN05216280_100729 OC=Pseudomonas oleovorans/pseudoalcaligenes group.
Sequence
MEEVIEQLRELNEPVPVPLELPEEETLVEIQEQILIHLPFELREYLLKVSDVVYGRLEPV
TASDPHSHTYLPEVASVAWDLGLPRDLVPLCQDGRDYYAVDVEGQVWLWDGDEGELTDES
WDSVWHWCRDVWLES
Download sequence
Identical sequences A0A087FF43 A0A1H6UB97 A0A225EED8
WP_074855771.1.21710 WP_074855771.1.57345 WP_074855771.1.95985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]