SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H7MT21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H7MT21
Domain Number 1 Region: 234-350
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.15e-22
Family N-acetyl transferase, NAT 0.0082
Further Details:      
 
Domain Number 2 Region: 28-93,127-187
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000497
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H7MT21
Sequence length 352
Comment (tr|A0A1H7MT21|A0A1H7MT21_RUMAL) Ribosomal protein S18 acetylase RimI {ECO:0000313|EMBL:SEL14199.1} KW=Complete proteome OX=1264 OS=Ruminococcus albus. GN=SAMN05216469_112132 OC=Ruminococcus.
Sequence
MDAIAEIRALAEEYAMCGGNERSDGTKFELFAPPATVEQVRAFEQEMHITLPNDFVRYLT
ELGNGGIGPDYGIWSLDKMRENNPYAPKIGDLLPMIGGGLSAEAWKAFAQEAEAAEDEEP
FEQRLVAGGIFISTPGCTMDTLLMCKGAAAGGVVTIDFDFLSYYDKPMERSFSFADWMIE
GLHDKIAYRKNGIYINQVTRYNENGLGMAGEKLTDLLIELRIAQLIEEGDVNAATLAPEI
RAFYERAFGNGTFRMWIAMSGRNVIGTVGLTLTEKPPYSANPTGKIGVLSSMYIAPEFRR
RGIAKCLLGYVIRWARRNGIGTIHITASEQGMKLYESCGFTHNERFMKYDLL
Download sequence
Identical sequences A0A1H7MT21
WP_081350550.1.72734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]