SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H7NNU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H7NNU1
Domain Number 1 Region: 243-355
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.16e-21
Family N-acetyl transferase, NAT 0.0081
Further Details:      
 
Domain Number 2 Region: 30-80,133-194
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000484
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H7NNU1
Sequence length 360
Comment (tr|A0A1H7NNU1|A0A1H7NNU1_RUMAL) N-acetylglutamate synthase, GNAT family {ECO:0000313|EMBL:SEL24637.1} KW=Complete proteome OX=1264 OS=Ruminococcus albus. GN=SAMN05216469_1169 OC=Ruminococcus.
Sequence
MDVIEEIRALAEEYEKCGGTERSDGSKSKLFDPPATIEQVREFEKEMRVTLPEVFVRYLT
ELGNGGIGPNYGIYSLDKMRERNPNAAARADLPVMIGGGLPEEEWRSFAQEAEAAEDEEN
FDKTAELEQRLIAGGIFISTPGCTMNTLLMFRGEAAGSVCTIDSDFLTWYSKPIESGCSF
EDWMIEGLHDHIAHRKYEIDVRTVTQYNQSGLGMAGEKLTDSLIELRIAQLMEEGDTNAV
DLAPDIRDFYERAFGNGTFRMWIAVHRGEVIGTVGLTLLEKPPYSANPTGKIGLISSMYV
KPQFRRRGMAKCMLGYVMRWAKRYGIGIVQVMASEQGMKLYESCGFMHSERFLQYDLRNI
Download sequence
Identical sequences A0A1H7NNU1
WP_081350576.1.72734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]