SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I0HLM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I0HLM4
Domain Number 1 Region: 22-319
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.72e-49
Family Ankyrin repeat 0.0000693
Further Details:      
 
Domain Number 2 Region: 345-505
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.89e-21
Family SMI1/KNR4-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I0HLM4
Sequence length 511
Comment (tr|A0A1I0HLM4|A0A1I0HLM4_MYXFU) Cell wall assembly regulator SMI1 {ECO:0000313|EMBL:SET84788.1} KW=Complete proteome OX=33 OS=Myxococcus fulvus. GN=SAMN05443572_103485 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MSPKKKLSPLDARLLAAIEDSNAKDVAKQLAAGANPNTVDAKGYPALHSAASEGSLEMVR
LLLDAGADVHAQDSDGAIALSFATAQSGDDGVALVKLLIDKGSNVNQRWNDETGPTVLTD
LFGEDNEEPSEDILAVLLKAGVDVNAPNGQEETPLMLAATFKDQPKLTELLLEHGALVDA
VNDRGWTALMWAIRSGNEGAVERLIAKGANVNHLATDDEGDTALTLTVNEDELFSTPSPR
IVSALLRAGANPNQPNARGWTPLHLAACIEDVEPLEALLAARADPHLANTVGYYPIDLAT
RRGYTKVIERLLAAGSPTREQAARKRMDGIWKQIGDWADKHHPDYASRLTVNRPATPERI
AALEKQLGKALPSDFRAFLQKFGGGAPSSRGLSISEYDVLPTEQIQDVWKGLREHVDNGV
FKKARPHELSKDQRFVKWTWWHPGWVPFASDSGGNLYCVDLEPEENGSVGQVIRWEIHGG
PLGPFADSMEDFFEEYLQKLESGRYDASELE
Download sequence
Identical sequences A0A1I0HLM4
WP_074952525.1.5308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]