SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I3YCP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I3YCP8
Domain Number 1 Region: 53-189
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000196
Family SMI1/KNR4-like 0.014
Further Details:      
 
Domain Number 2 Region: 197-263
Classification Level Classification E-value
Superfamily ClpS-like 0.00000262
Family Ribosomal protein L7/12, C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I3YCP8
Sequence length 317
Comment (tr|A0A1I3YCP8|A0A1I3YCP8_9BACL) Uncharacterized protein {ECO:0000313|EMBL:SFK29644.1} KW=Complete proteome; Reference proteome OX=1884381 OS=Brevibacillus sp. OK042. GN=SAMN05518846_11168 OC=Brevibacillus.
Sequence
MINSKNKLMNLLMTRGGALADKFTDMDAVIKKMQEVVAAKREQDPEFYAKYPINLETLAD
DQAIREVTDQWSLPDDYVYFLKHYVPESVTWSTDEYTNLEIYGAKDLLKGQWGYNYNPVT
HEDIVDWPSSYVVSASDEGDPYCIDLSRGDTVIYTAAHGMGTWDFSVAYGNLEEFLHSVL
VPRGFEEWDTSGDEPYEYYKVFLTGEGSDKKKTLLFIKKMFSCDFSQAKAYLEAAPLLVY
KGLKHGAAKTGEQLKSIGAEYEVRKVSVDTRAISPSHVQMLPNALASSGCYSFLIKGDKN
PLLRIFAHCLWSSPLLQ
Download sequence
Identical sequences A0A1I3YCP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]