SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I7UE25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I7UE25
Domain Number 1 Region: 421-722
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.56e-24
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 220-369
Classification Level Classification E-value
Superfamily L domain-like 1.3e-20
Family L domain 0.034
Further Details:      
 
Domain Number 3 Region: 70-207
Classification Level Classification E-value
Superfamily L domain-like 8.79e-19
Family L domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I7UE25
Sequence length 744
Comment (tr|A0A1I7UE25|A0A1I7UE25_9PELO) Uncharacterized protein {ECO:0000313|WBParaSite:Csp11.Scaffold629.g8389.t1} KW=Complete proteome; Reference proteome OX=1561998 OS=Caenorhabditis tropicalis. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MAFGMRKSVRECDGIYISSNAQLKNADALSNVISWNPSIWHIYDNPKLNFGPLCGIGLEK
LVIDLDVYGNLRDCECKAVLLHLFSLPYYSNCTTIIGGANKGLKISGFSDSKDLSSVLSL
KNLTSTVEIYETSFENLSFLGGIEEIGLEATNAWNIILIRDNPELRRLGFDSLKKLTPEN
GQFFANIPNNHPDLCLSTNELQVLAYHFVTLRFDFLSICQDLYRKDGEKTCIFGDLNTMD
AGCQHVIGDVVIDSGNEKNAWKLENMTNVYGSLTVEETEEMEELKFAARLRQVAALRFDR
HHPMIRFNYNKNLRSVSLPSMKSAPYPYDDDQIIEIYGNSMDIFKYQKECLLFQKLVRTA
VKYNKKSCDKLPTGGTLITNYTDDFIYDTDPLNKGHLDTRDYLFDKSLIDVYQSIIDHLK
TTYNICAFINLFVNLPHFLILLQKEMRSNIVYIVMIGICISDITHSIGKITQVTVGWLFQ
DVCPGVYPFYYIMVDVMARCSQIMSRRSSSALALFIVAFRAFSVAFPMQNSITMTTGIVI
VTFIMIICISWSSLYYFLTNIVKQTQCPDLFIGRQPSWVMYIHDTFGKSEGMLRVIDGYM
ALFVSLLYVFVAFGLVVAVSRARRRRKSLKNEKSSSNTQALVIMMAMFMFISESTYGALF
LLSSFFFVDFEERTYLEQLEVFAMTLSMINSIAHCLICFAMSSQYRDVVMRLWNHLYIQR
PSSLLNPVPVFKGRDDQIIVYFII
Download sequence
Identical sequences A0A1I7UE25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]