SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8B7E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8B7E2
Domain Number 1 Region: 1101-1302
Classification Level Classification E-value
Superfamily vWA-like 5.98e-51
Family Integrin A (or I) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 3208-3242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.03
Further Details:      
 
Domain Number 3 Region: 1663-1806
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000377
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 1507-1672
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000659
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 2231-2264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000108
Family EGF-like domain of nidogen-1 0.039
Further Details:      
 
Domain Number 6 Region: 543-684
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 3251-3292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000456
Family EGF-type module 0.026
Further Details:      
 
Domain Number 8 Region: 974-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000487
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 9 Region: 1874-1906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000524
Family EGF-type module 0.059
Further Details:      
 
Domain Number 10 Region: 2764-2855
Classification Level Classification E-value
Superfamily SEA domain 0.0000628
Family SEA domain 0.018
Further Details:      
 
Weak hits

Sequence:  A0A1I8B7E2
Domain Number - Region: 2181-2213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 32-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000239
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number - Region: 1980-2014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000323
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 2031-2064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000336
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 853-888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000524
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 2640-2669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000528
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 1817-1855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000977
Family EGF-like domain of nidogen-1 0.066
Further Details:      
 
Domain Number - Region: 2079-2112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 103-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 3104-3138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00315
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 709-836
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00439
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number - Region: 3154-3185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00587
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 308-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00806
Family EGF-type module 0.082
Further Details:      
 
Domain Number - Region: 2333-2360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0143
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 2531-2671
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 2129-2160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0203
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 2280-2316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0378
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 270-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0713
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 498-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0731
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 2435-2469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0965
Family EGF-like domain of nidogen-1 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I8B7E2
Sequence length 3584
Comment (tr|A0A1I8B7E2|A0A1I8B7E2_MELHA) Uncharacterized protein {ECO:0000313|WBParaSite:MhA1_Contig147.frz3.gene57} KW=Complete proteome; Reference proteome OX=6305 OS=Meloidogyne hapla (Root-knot nematode worm). GN= OC=Meloidogyne.
Sequence
MQMLLLFATTLLSLTDILLATKSDFCSSFGQFECNCGNPRCIDSNSVGDGVADCSDASDE
IRESSNIPCGDAKIPRKSANNFKRNDDGTPRFCSKEKLRNCPEELGQICVEWPRNHQKCV
CRLGFFRAPGHAACLPVESFPHLNVSKVVDLSDEYASGRLNCSRLVSDLSMMYPGIFLFR
REGEAGGDEGEDKDERISTNNRRLNNKLPARDEPPVSDDDISDKEECTLIDGIDENKIGG
KGCSNGKICVVSGNKQNNNEIKGNATVKGICARCIDNNFGYECLCPEGYLDTSLNPQQTP
GRSCRKLINECLNPLQNDCSPNADCLDELVGFTCQCRLGFVDIGDEKRRGRKCVKNADTK
DNNKLCIGKNCEINLPPPEAICDERAPEDATYHCHCPAGFIVEYVDESQSVDFSKGKGKK
QHPRVAICLPIGSSEDEETTQQQQGYTNNSCLHCDLATSECVGGVCRCLPGLIPLQSQQH
NFTNLKFSCVKSNGKYRGANPCQDYSLNDCDSVAECDSDQPGYFQCKCPSGYLDISPDKI
KMPGRICKKVENECTSGKHKCDANAECIDTSDGYTCRCKPGWLDTSTDKEHSPGRSCKQS
SQCRNIDCAPEAECVENVLAGQPPICKCQRGYVDVSSKQGKLPGRICRLVRNECQHGEND
CSRDASCIDTDDSFTCQCKDGYSDESPQKDKKPGRICIRKNLPPTPECDVNDPMSCDKTR
HEACQFMSGTYRCACANGYSRLPDGRCLAINECLDSRLNDCSPDAECIDQTIGFSCKCKN
DFVDVSPSGSRSGILCRRRVNECSAPKQYDVDCDSNANCIDTDESFICRCRPGFVDISEQ
FNRLPGRRCIEAVNECLDSKLNDCSEHAICEDSKESYTCKCKSGFLDTSPDARKYPGRLC
IKPIQEKESNLTSNPFQLSLDTCDQTKGINACRKGLECIEDTDGNFICACPEGSFLYSDG
TCRLTSACKLSMECDKNAICVNLFDSFQCQCRPGFFDKSPDPETKPGRICKELVNECANQ
AHDCSPFAECVDATDGFACICKEGFVDISSQHELLPGRRCSNASNECADRSLNTCDESAD
CIDTQQGYSCRCIPGYVDVSTSANLPPGRVCTVQTSCPKQKTDLMFLVDGSGSIGSAVFR
NEVLRFISDFVELFDIGQENTRVGLIQYSDQIRHEFDLNQYSDKHSLLQAIAQTQYLTGL
TRTGAAIQHMVQEGFAQRRGARPPSSDVSRVAIVITDGRSQDNVTEPAQMARGQHINTFS
IGVTDHVLASELESIAGSQQRWFYVDRFKDLDMRLRSIVQKLACPSPSRPTQLSTGCSVD
AQTGCDRTRNEICTLINKKPTCHCPNGGFDRHPLTHVCGGELCNPELPTSCPHPELCQRT
PFGNHRCACPASYAREMHSGICISSSISRISSGQHLPSNFTSTTFSPSLAVKTCPPGMAL
NPRSGNCGPPGSCDPLRKSEDECDIRKREHCLLHTSGQFHTCQCLPGEKRHPATEICYQS
PDPVNKPGRLCVGEVNECALGQTRCSPDALCVDTPEGYICRCKPGFVDLSPNARHESGIV
CRKLVDECSREELNTCHPDAFCVDTHDSYKCICKAGFSDLDEFRNPGRQCVKVQESNSKC
QEGRNDCDKNARCIYDASTDKYECVCPPNFRDKSVDLVNAPGRVCIPFIPECDNPALNDC
DLPDHAICTDTDEGYTCRCRQGFLDISPNVTHKPGRLCKQLENECAKGTHDCAKEGGICQ
DTPDSYTCQCSANYLDVSLDRKTRPGRNCKRLVNECAAGQHDCFPTAICTDTEDSYQCQC
PKNYLDVSSDPLQKPGRRCLAKIDECTQGLHDCSPNAICNDTDSGYTCKCSQNFVDESPE
SAQRPGRICRPALVNECVLKKDDCHSDADCLDLAQGFTCQCRSNYLDQSSNRVTHPGRYC
VPRPTPPPDECQLTAVNKGCKAELNEVCRIVGGQPKCACPLNYERATTKNNTGTAACTVI
NECQFPQLNDCHPSAECQDLVDGFTCKCRSGFKDISPKANERPGRLCQALVNECQFPHLN
DCHLHAECIDLEDSFQCRCKKGFNDLRPERPGRICKQMIDECERPELNSCDRNAKCLDEE
DGYNCECKSGFADVSPSPNLSGRACRPIVNECVDQKLNDCDPRAKCIDQPDGYQCECPSN
TKDISPSAAFPGRVCHVFENECLTGKHDCDPQAVCQDNEQAFTCECPKGFTDRSPNRQHR
PGRVCVKLVDECKEGRHTCSPNADCRDLEEGYTCECRDGYVDRSTNLAIQPGRVCGVPET
CPANHECSAAAVCEPQGGNNYTCTCIQGYIDQSPDGVSGRICVRNSFCRDPKLNNCSRKA
VCYEEGQGYRCECARGYLDKSPSGQPKGRVCELPPPPPPPQRHPCQDSSHDCHQKAACRA
TGAAAFTCECLPGYEDRSPDVKTKPGRVCVLTEPICIDATRNDCHSAAVCTEDKRLPEGF
ACRCRDGYVDQSPDKIRKPGRICVEFVNECLDRALNDCDPLAICEDQSEGYTCRCPLNAM
DRSPDKERRPGRKCISQINECANPSLNNCSRFADCFDKPEGYECRCRPDYHDLNTAQPGT
SCKFMQNECLNLALNDCSLNADCFDTPSGYNCKCRHPFKDHGPAEHPGRICLYNECQDPT
RNKCDKNAICEDTEDGFTCRCNDGFYDDSGTKGLEAGRVCIAFSENEQPEHITQRPSHQQ
QSTVIKGIACGRNHWCLSERNEVCVGGTRCLCRPGDGRASNEQKCVPVDRTSFAFRVISR
GSQPLFYSSDYGDSSSSTYVEFVQEFQRELARAIGSTKFAPHYVTTDVSYLTHPKAINSS
WSDGLLVNFTIASNKNQQPLNRCELWEQLSSSIQHSNGAIGNNGQLIVAPDFELLNPCIK
QLPIGDYCGGSEDTAAICKKELGEICIAETLCGCPNGQKRPSTEEKCRPVESWPIPLWII
RRNNHNLAFNETFANPLNPLNKEYVRLFEKGIAQCYPQTLLKNAFVSVEVNEILDPMLIN
SSWDNGLLFNATMHFRKGAVKNPLDVYTQLVKYIIDKNGQQLGSSGLYLSSNQKNPFSSC
FKNNCHPKGICIELGPNAYRCECSNGQRDLNPSDPGRKCVPTQSYNECEREEENECSTEA
RCIDLEFLYKCECKKGYTDASPKGSIPGSVCVLDYCSDVNYCPSNTSCVNTEQQAECQCH
KGFIDIRHSESRMSLGFSSDQYCLSPRDVDECALGLHNCSSYAICTNLPEGYQCQCPSGW
EDGNLELPGRFCASKLCAQCHENGACIPDPTNNTNVICQCFDGYSGQFCELAPAAASLVL
LVLLALVFLLLSLCFLLYLCTRCRCFYRRPEFATLDASASSDSGADFSLYGIPRAKLKQS
SHTDSAADSRAAQLAGYLEDGIRIPRAHLHHDGSSLGSAASSEFTIREEIERRVTTDITR
TEEIVTDVDVHNEATALSSENIAEASNAFPSTLGTSTNLRKNQQYQRQQQHKLIDNELDR
GESIAEFSNSRREGGGGISSSNRGITINHPSSSWRHYATTNDSLKKGFAFKNPALENDED
VDIIDKNTTVRHHRHFDPRTGISSDKHIQQSSTISSTTRSGGKY
Download sequence
Identical sequences A0A1I8B7E2
MhA1_Contig147.frz3.gene57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]