SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8BC35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8BC35
Domain Number 1 Region: 83-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 41-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000105
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I8BC35
Sequence length 241
Comment (tr|A0A1I8BC35|A0A1I8BC35_MELHA) Uncharacterized protein {ECO:0000313|WBParaSite:MhA1_Contig1797.frz3.gene10} KW=Complete proteome; Reference proteome OX=6305 OS=Meloidogyne hapla (Root-knot nematode worm). GN= OC=Meloidogyne.
Sequence
MNKVYLIALLMMTFLGLSLCKLQTSQNSNTNTIDLATQNCSGNFDFDCGIGELNKRCISI
FWTCDHIFDCTTGADEGLNCKYLHQCPPGYFMCRNGDCILANKRCDSSQDCLDRSDERAC
FDSNPKINVVDQHAEAFVEYDDQNDGPSFSILLFCLLLLVCFVILLIYCVVRRYPDTKFR
VDNALKVFNHTMTSIPSRISGRSTEARVNILVPTDDSHYFDNPLSTLQPPLTLNVSEMAN
V
Download sequence
Identical sequences A0A1I8BC35
MhA1_Contig1797.frz3.gene10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]