SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8BFG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8BFG0
Domain Number 1 Region: 23-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I8BFG0
Sequence length 70
Comment (tr|A0A1I8BFG0|A0A1I8BFG0_MELHA) Uncharacterized protein {ECO:0000313|WBParaSite:MhA1_Contig210.frz3.gene6} KW=Complete proteome; Reference proteome OX=6305 OS=Meloidogyne hapla (Root-knot nematode worm). GN= OC=Meloidogyne.
Sequence
MSLNPKRSVQPSHAFAASKASEDCLAGSFVCREDRTCISPDLVCDRKYDCADQTDEKTCG
ELNIFNYNFE
Download sequence
Identical sequences A0A1I8BFG0
MhA1_Contig210.frz3.gene6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]