SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8BT25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8BT25
Domain Number 1 Region: 504-569
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000131
Family Tachycitin 0.012
Further Details:      
 
Domain Number 2 Region: 99-151
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000105
Family Tachycitin 0.044
Further Details:      
 
Domain Number 3 Region: 703-756
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000175
Family Tachycitin 0.057
Further Details:      
 
Domain Number 4 Region: 585-643
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000785
Family Tachycitin 0.057
Further Details:      
 
Domain Number 5 Region: 269-334
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000262
Family Tachycitin 0.017
Further Details:      
 
Domain Number 6 Region: 1070-1129
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000034
Family Tachycitin 0.019
Further Details:      
 
Domain Number 7 Region: 986-1047
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000785
Family Tachycitin 0.056
Further Details:      
 
Domain Number 8 Region: 1147-1200
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000246
Family Antifungal peptide scarabaecin 0.069
Further Details:      
 
Domain Number 9 Region: 344-400
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000706
Family Tachycitin 0.044
Further Details:      
 
Domain Number 10 Region: 846-898
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000123
Family Tachycitin 0.044
Further Details:      
 
Weak hits

Sequence:  A0A1I8BT25
Domain Number - Region: 29-84
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000523
Family Tachycitin 0.06
Further Details:      
 
Domain Number - Region: 811-837
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0251
Family Tachycitin 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I8BT25
Sequence length 1358
Comment (tr|A0A1I8BT25|A0A1I8BT25_MELHA) Uncharacterized protein {ECO:0000313|WBParaSite:MhA1_Contig512.frz3.gene8} KW=Complete proteome; Reference proteome OX=6305 OS=Meloidogyne hapla (Root-knot nematode worm). GN= OC=Meloidogyne.
Sequence
MSLKLIILFSFISSFLILLVSSAEPQFRNPVNCANLPDGNYVWGCSRFYSICTNGRELAM
NCYHNLKLNPGTNQCEEPHSIPICASGGSAYAHQLYRAKDPFTCNNKPNGEYESSVCSST
YITCDNGKKIERECPYGLAYNQKAGACDRKEKCKPDKGAPVHGNVRKMRASFPFNPFEDS
FGGFEAPSFRFAPGPPAYVPPVYAPPAYAPPPTTTPPPVYVPATPAPPSYVPPQQPAPPA
YAPPAPPAQPPAYAPPSYSPAPPPAYGPAPPPQFDCSSKPDGLYEVPSGGCTDKFWKCAN
QRAFLYQCPPNLAYYAVGKYCDYKFYVPACGGSPQPVQTSTAGPPPPPTYDCSKKSDGLY
GAGNCTSSYFFYCSAGKTTVMQCASPQLVFDEVNQVCEYSGECGKQKLEEPKPPSYGPAP
PSPPSYGQPPAPPSFGPAPPSPPSYGQPPAPPSYGPAPPSPPSYGQPPAPPSYVPGGGHF
YRNKRNVPQPPQYLPPQPIQPYVQPPISFNCSGKADGYYVKDGCSKDYYTCSNGIAYLTT
CPGSLFFNIVKKQCDYKENCPPPPTPSPPISPPYSPPAPIPPPQTPPPPPISCKGRKDGF
YYQKACEGYYYVCSGESAFTQYCPAGTLFEPVKAECTFKDECGKKPPQPYTPPPSISTTK
LLLSNNIFSSQQQQNSRIEILPSPQLIYSQPEILPTQQQNISLSNKCLNKIDGFYLKSKH
CQNKYFVCSGKRQIELKCPEGLLFDTNIGQCEYSINCSKLIFKKEEKEKEENLSKNIQKY
SQIFTTTTILPPPILPQSAGTFSCKGRIDGVGGFPQRLKCPDNLLFDPINVLCQYEHLCG
KTIKGKRNGYYAKSTNNLKECFVSSHFYSCLNEQSNILKCPENLVFDINTVSCQYKETIC
PKNEKQINNFEQNNYLKQYTAKQIKQQTIPLIYSSPPPIIVHPAPSLVYSEPSQTGIKGI
QLPLRPYNLPTPIIIQKEQQKHLNNTICLNKNLKLFNSNNGCNNYFYFCPTKEGEYIHKL
DCPLGLFFDEDKQQCNFRENIKKCGGNDLKNLFKNIPTKHYSKENDIYEEFNCTNKAIGY
YSFGCNGIYYSCTGTTIYLFNCPSNLKYSQQAAQCDYDENVPECSGKQLNNPKQILKTKI
EKPISNQCINLFNGIYGENCSNYYFICINSTIYDYKCPENYLFNKNTQNCLLNEYLQECN
NKNEMIKTIVKACPDKVVHGQSGTPAKNGQSGTRQSGTGQSGTGQSGTGQSGTGQSGTGQ
SGTGQSGTKDIVVQDKVVHQQKMDKVVQDKVVQDKVVQDKVVQDKVVQDKVVHQQKMDIV
VQDNKWNYSLLQAVKRWNYSLEQMAFDKLNYQCWKLIV
Download sequence
Identical sequences A0A1I8BT25
MhA1_Contig512.frz3.gene8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]