SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8C5F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8C5F2
Domain Number 1 Region: 207-333
Classification Level Classification E-value
Superfamily PapD-like 2.18e-25
Family MSP-like 0.001
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000419
Family CRAL/TRIO domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8C5F2
Sequence length 428
Comment (tr|A0A1I8C5F2|A0A1I8C5F2_9BILA) Major sperm protein {ECO:0000256|RuleBase:RU003425} KW=Complete proteome; Reference proteome OX=114890 OS=Rhabditophanes sp. KR3021. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Alloionematidae; Rhabditophanes.
Sequence
MNLDFFKFFFKSFKYFYPSTLQSIYLMDTQLKLQPSWKIIKSWLDPSLLSVTHSVTSTSI
RNYVAEEFVPRSLGGYDDFEFKMADLSRCISNTNSQTDSGYYENADQIPNLDMTMMRKTV
SFGEEDECVARVSPLTMSAADGNKMITSVNGSLVGNSESERLSRKNSKGNLPPSVPPRSG
SIKRNGHIPIHLRGLVEQKLNAPADDWFQNDFVAMIPSNEITLKSVESENDSVDIVILRN
VSNETVFYKIKITSPEKFRVRPSTGILKPGAKEVIRLYLQNEYKNNISKDKFLLMAMAVE
ENASFDNFSKIWSQKSDDKKIERKIKCTVEDGSADRNIVSSMKKHSLSSSPVNSIYESNE
LKSIIKTQNIILLLLAVICIIQVVMLVKVFGSSDLSINNHDLCPKAVSNDLPLADQLTSS
LPFQNDEL
Download sequence
Identical sequences A0A1I8C5F2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]