SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8EFP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8EFP6
Domain Number 1 Region: 498-570,642-746
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-42
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 35-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000275
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 165-193
Classification Level Classification E-value
Superfamily Notch domain 0.00000863
Family Notch domain 0.0047
Further Details:      
 
Domain Number 4 Region: 200-231
Classification Level Classification E-value
Superfamily Notch domain 0.0000157
Family Notch domain 0.0067
Further Details:      
 
Domain Number 5 Region: 78-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 116-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8EFP6
Sequence length 899
Comment (tr|A0A1I8EFP6|A0A1I8EFP6_WUCBA) Uncharacterized protein {ECO:0000313|WBParaSite:maker-PairedContig_1868-snap-gene-0.1-mRNA-1} KW=Complete proteome OX=6293 OS=Wuchereria bancrofti. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MLKSYRIQRSTCCVAMVLINVALALLNCLLALPSCFDPAEPCLNGGVCVKQITNKAHSTL
CSCSAGYSGKKCEKVLDVCEAFPHYCNVGTCVNINGSAICQCSMGYFGHNCEYTFDKCKL
GNMCRNGGTCIDGICFCTDGFSGEVCERHVPERDDYLRAGCEEHPEFCSLRFADGTCNEE
CNNEKCFFDGFDCVVNTQECRLSDYCALHYLDGKCDEKCAVAECGYDGMDCDRNLLLRNL
TDSSTIGIVFEGPPPNKLHNPVRLALDSNNKTRIYEWSFENGVGKEINLKEWEMSRNATG
ILLYVDIDSTFCEQRLHLDTTNVLPCFTDIFGAVAYLHTALYDEAKNRISLGDVTVEGLF
VESDRSRSLPTFAIFITCFVFIGIISSCFYGIYGFFGVLKKQNIGKNHAPLHCKVMPPVG
QQYRPLKTTFSMRALVGGMDYHHCLGFSQIQLHAGENSRKMLFKNHYRTAENDEQKILIS
LDAYFSDNGNEDCHLGPDLLKAVKCNDIEAVSFLVFHGADVNCYDSDKNTVLHHAVVVNS
DQIIRLLLSTHRCNLRAVNVLGQTPLALTVRFAHVSDLCARCILDFMYTEYYRQAKVRND
TFTPQLIPSLPQNGVSRLMTSNNYRQFDPSLKQTERVGSIFTRDILSEKDDPTLTDIFGR
TALHYAALNRRVNLLPILYSFGLKLDTEDIKGETPLYLAAREGHLDMVNLLLSFGANSEI
SDQLGCTPLDVARERGHCLIVEFLENVAVNNVDIMKTRKRKRSRKLSSAAKCKSKLGSHI
PVASSQEDISLASSSIAIGLNEECTEDVDDIDEDMAISSSFLNSVESFVLTPAGQIIAEA
EKELDLDVVDPAVPDYIDLSTNSCLPTEFFSNNAFSVEPFQADESTEICFERRPSTILQ
Download sequence
Identical sequences A0A1I8EFP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]