SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8EM28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8EM28
Domain Number 1 Region: 31-331
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-42
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 277-461
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000352
Family Ankyrin repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 511-556
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000746
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8EM28
Sequence length 634
Comment (tr|A0A1I8EM28|A0A1I8EM28_WUCBA) Uncharacterized protein {ECO:0000313|WBParaSite:maker-PairedContig_2857-snap-gene-2.13-mRNA-1} KW=Complete proteome OX=6293 OS=Wuchereria bancrofti. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MKRTRPDWTSSSIREFEEESIVVESNVTVGVACRLGNVELTQQLLHAGYGAFPDDRSWWP
IHEAAYGLHLECCKVLVESGKSGRCNVNAQAHDSVTPLMLVCRMSSRHNEALEVARYLLD
NGANPNGRTLDEMTPLIQAIKSKNTALALLLIDRGASPLDVWYDGWSALHESADTKNLVI
MQRLIGLGADIFAVDVKRHTALMVAVQENFFPGVKLLLKVARDRAAELADISVENGLTCV
MAAADAGFEDILLLLINHGADCNITLHPIWGDDGSRIHAIAAAALNNHPKCVELLIPHVN
KEILKETEIDPVSAAAYSGSYECICLLLDAGFSTEVPMCSCEPVGMIIPYLRPLFSRRYH
TPLREAVRKGYTLVVERLLKAGAKMTYVKNCFSPFLFAFRNRIDPAILYKFLENDVDINA
MSVKRTCDVPDALVSALGTCNRRQLLLLLSCGLDPALKNWCKCNNGYSLMYDVMQTTYVT
DVDKLMKLLILFSSGIPSCCNEVAEVIGAQPKIPELLHLCRLAVRKCFPTSKLLHGRFLD
YLPIPKSLRDYMIFHPIPEELRPTDKSLPTLIRDHLFLGAKIRPIKGKQSIQILEISFFF
FLKPDSIEFKPFHLPNEFFQSESTVRRLMSDKKY
Download sequence
Identical sequences A0A1I8EM28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]