SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8JB15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8JB15
Domain Number 1 Region: 2345-2730
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.95e-66
Family Ankyrin repeat 0.00046
Further Details:      
 
Domain Number 2 Region: 1726-2113
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.25e-63
Family Ankyrin repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 1459-1848
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.82e-60
Family Ankyrin repeat 0.00056
Further Details:      
 
Domain Number 4 Region: 2675-3033
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.85e-60
Family Ankyrin repeat 0.00061
Further Details:      
 
Domain Number 5 Region: 2054-2304
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.28e-32
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 3132-3222
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.83e-20
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 557-657
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000356
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Domain Number 8 Region: 1052-1113
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000721
Family Retroviral integrase, catalytic domain 0.058
Further Details:      
 
Domain Number 9 Region: 2312-2361
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000615
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8JB15
Sequence length 3999
Comment (tr|A0A1I8JB15|A0A1I8JB15_9PLAT) Uncharacterized protein {ECO:0000313|WBParaSite:maker-uti_cns_0046568-snap-gene-0.4-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN= OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
PDTAMPRLRIITPQRLATGTAEDTILREVIQRVTTGNWSSAKDTKLQPYVKVREHLRIWQ
DGPCLAFQDRAIIPQDLRGELLEFAYAGHPGVVRTKQQLREFAWWPRMEADVETFVRDCE
TAEKLSSCDRLCCSPCHGQTRRGQRSPSTSWVNCRQRQHRYNSYWSSRICTNALLQFLES
YRSTLHALTGKSPDELMLGRHWCTSMLLLAPVKNGTAAKSNIAKRIQQRQQETAEYTNQR
RGAQKPTRPGKLGSWHSAVLQIPYTVPQQAAAAASHPEQDRVKQSYHDLHESDTIETLDD
AINSAETCPPAPFNSRENFDDFLSRMSAFMSRFPGLGEHGKIATLIAYLGPAFATYAAWF
DQQCVLHGLPVGSNLEHLPGARYDSLLQFLRARHGGAKSTALLRLELRSRCRGKDETFEQ
FLTALQRLAVKAFPDAGAHEFLQQAVLDQFIQGLNNSYVTERLLNMPMPVTTTEQALRWA
QQIRETQQFLEGQGQNQQHQRGTATSAPVVGSAALPMHGQRPGELPKRQGGWSTGPVPAL
SALSKSAPPSRPSCQPGQARFVTARICRRRRPCLIDTGAEVSCISLNIARSIRRQFKPSK
TTIYGVSGNPASVLGEIHLYFSLGSVQFQHTFLVVTDLNVPIILGCDFLDKQDCSIHLGS
GCLVFNGLGATVPLRKSKQAAQSSKLVAAAAVQLQPGEGWTVPVRPLHVTAWTSSEAPGI
VNGSRSSKVLIARCVAKISNNGMGVAIINASDAPVAVREGDTIGWFTPLSSQGGTQLQST
SMATATTSIDGNAPWLREVHIADEISASEQQQIRDLLLEFNDTARPAANVACQAEKFAET
PVQTASTPCQVEAGGTKLALVNVATTDPAPSAADPQNDPRTAGRAPSRRKQQLQPRPSES
EEFSDSDDQDDDGDDETGQARAMQSNESLTLRERQLKDADIGPVFRLLAKGKTRLSDQQR
ARLPPGSLILAQKIKELCFVDGALHRLVESKQQLIDEIHEVGHLGEAKTLAGLKSRCYWP
KMSESIRVAVRACQVCQRAKTSGHQRAPLRSIVSSFPMQRIGIDVVKIGVSRHGNDRLLT
IMDYFTKWVELVPMPDEKAATIARALFDNWVSRSVNATSGFTPHFLMTGREVTLPLDIVY
RLPEPPRTTGQFAADNRDRLLSAFESVRLATAAAQRRQRRYYDQKAARRRFRAGDLVWLF
VPPSALSRTSGLPPKHQAPWTGPFRVLRRTSPVNYLVRPVEYKDGDAGRVVHVNKLKRAH
QPRPPDQPRSGAASDDSSEVLDADWVLRRRLASPQSSTARSLVECTTECQTAASCEIPPK
SEALPSTEVNGDLGNSVAKWSLSAAKWIATIANIENLTHAATSLSWLECTRDEQAKAFGE
TGRANPLLLGNRSSATAAIGKASGQVGHEKRSQTSHCTMGQLSLIKYSLGWPLQPQPLRC
HAGCTEAKAADSALMHGYLPDAASHGHLELVKFLVPTVADQKQRDYCCIKAAESAAVKGH
IEIVKFLVPTVADQTKRDDCCIKAAEYAAVKGHIEIVKFLVPTVAAQTIRDDCCIKAAGS
AGRYGHIEIVKFLVPTVADQTKRDDCCIKAAGSAGRYGHIEIVKFLVPTVADQTKRDDCC
IKAAEYAAVKGHIEIVKFLVPTVADQTIRDDCCIKAAGSAGRYGHIEIVKFLVPTVADQT
KRDDCCIKAAEYAAIKGHIEIVKFLVPTVADQTKRDDCCIKAAGSAGRYGHIEIVKFLVP
TVADQTKRDDCCIKAAESAGRDGHIEIVKFLVPTVADQTIRDDCCIKAAGSAGRYGHIEI
VKFLVPTVADQTKRDDCCIKAAGSAGRYGHIEIVKFLVPTVADQTKRDDCCIKAAESAGR
DGHIEIVKFLVPTVADQTKRDDCCIKAAESAGRNGHIEIVKFLVPTVADQTKRDDCCIKA
AKSAADEGHIEIVKFLVPTVADQTKRDDCCIKAAKSAADEGHIEIVKFLVPTVADQTKRD
DCCIKAAKSAADEGHIEIVKFLVPTVADQTKRDDCRIKAAEYAAVKGHIEIVKFLVPTVA
DQTKRDDCCIKAAASAAFNGHIEIVKFLVPTVADQTKRDDCRIKAAESAGRNGHFEIVKF
LVPTVADQTKRDDCCIKAAKSAADEGHIEIVKFLVPTVADQTKRDDCRIKAAESAGRNGH
FEIVKFLVLTVADQTKRDDCCIKAAASAAFNGHIEIVKFLVPTVADQTKRDDCCIKAAEY
AAVKGHMKSSIADQTKRDDCCIKAAKSAADEGHIEIVKFLVPTVADQTKRDDCCIKAAEY
AAIKGHIEIVKFLVPTVADQTKRDDCCIKAAESAAVKGHIEIVKFLVPTVADQTKRDDCC
IKAAEYAAVKGHIEIVKFLVPTVADQTIRDDCCIKAAGSAGRYGHIEIVKFLVPTVADQT
KRDDCCIKAAKSAADEGHIEIVKFLVPTVADQTKRDDCCIKAAKSAADEGHIEIVKFLVP
TVADQTKRDDCRIKAAEYAAVKGHIEIVKFLVPTVADQTKRDDCCIKAAASAAFNGHIEI
VKFLVPTVADQTKRDDCRIKAAESAGRNGHFEIVKFLVPTVADQTKRDDCCIKAAKSAAD
EGHIEIVKFLVPTVADQTKRDDCRIKAAESAGRNGHFEIVKFLVLTVADQTKRDDCCIKA
AASAAFNGHIEIVKFLVPTVADQTKRDDCCIKAAEYAAVKGHMEIVKFLVPTVADQTKRD
DCCIKAAKSAADEGHIEIVKFLVPTVADQTKRDDCRIKAAEYAGRYGHIEIVKFLVPTVA
DQTKRDDCCIKAAASAAFNGHIEIVKFLVPTVADQTKRDDCRIKAAESAGRNGHFEIVKF
LVPTVADQTKRDDCCIKAAGSAGRYGHIEIVKFLVPTVADQTKRDDCRIKAAESAGRNGH
FEIVKFLVLTVADQTKRDDCCIKAAESAYSNGHFEIVKFLVPTVADQTKRDDCCIKAAES
AAVKGHMEIVKFLVPTVADQTKRDDCCIKAAASAGRYGHMEIVKFLVPTVADQTKRDDWC
IKAAESAASNGLQDVVEFLISFLSSPDQRANLRFQCAVATCSRLHEDVAAFLGLEPDWLF
QSSTILSFTAAMAIEGRNSVLTDTLSRMQPPHITQLLRLSISQRHVALAVTIAVTLINDE
RVSTQHVDLPEDSTGATALMLAADAGHHELIEKLIDLGASVRAEDSQGRTALSRACEAGH
VRAAKALMDRGADASHRDGRGQTCAQVAQRFEQQQVLRLLHPSEAGSPEARQAAAHRLES
GRHRLSDDSQQDRRLSEELHRLLSEAGFTEERAKCQQRLADWLEEVAQVLTQDDRQMTGS
YAEGWANSLVQVNGRTAADSDIDWTVLVAGQEFHLEGGCDREGYRSCRDATRLQVMEGHA
QVAVGAGSQPAVTATACGVRPAQDTCHAIECCSSFCEDRSRKPVLFNNRVHLVRATRPSS
TNELRVSFSFQEKYIMGRLSTVQGQLFTLIKFIFKRHLPLTLDTPGLKTYHAKTLLFTML
EKHGTDTETDAWKLHNLIALLKESLDLMLSFIDSSSSPDECMPHFFMPDAPLYFKNAGIG
GDFDNTKARVRDGLFELRSDIGGVVEQLRRLVRPLQSEKFYFHPFTLLPLTAPPAVTEIR
EGSGYTEMYYNFADVYSVVHQCTLFTARLSQPLSSHLYVNFRCLSWSLQAELLCNRAPAI
KLDDWKRELEEDPDLEELLTLAHYSDCREHVELSLQQMEMIEKERRVVMETQDEEKIGWV
RQKRWRVSNRSGSDSGAHRSREDEERRLWARARLRRDGVDLGRFVAMETAAEQRDSWTHV
KLIRMRLQVAHELPCEFICTDGRIVAPEIEGSGGGTGGVGVDGSGGFHSFRRSDASVRIW
IWEDDDEAEDLGNVGEEAEDLGSWGQVPEERCPFCRSGSENAEHFICHCPVFTRARLTHL
GPNPARFSPTFAGPRASCCSPGTSGTRDELSSSPPSVRRTALQARPTGPPERHHFNGSHW
SPGASGMGGLLRLLAASAGRPLQLIQSLLSPKNTNLLSI
Download sequence
Identical sequences A0A1I8JB15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]