SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I9FZP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I9FZP8
Domain Number 1 Region: 1750-1809,1838-2058
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-52
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 29-109,181-378
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.58e-45
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 518-647,721-776,849-867,897-967
Classification Level Classification E-value
Superfamily L domain-like 2.52e-31
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 4 Region: 993-1015,1043-1212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.25e-22
Family G proteins 0.0095
Further Details:      
 
Domain Number 5 Region: 2103-2397
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000377
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I9FZP8
Sequence length 2511
Comment (tr|A0A1I9FZP8|A0A1I9FZP8_BRUMA) Bm6044, isoform b {ECO:0000313|EMBL:CDP90956.1} OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=BM_Bm6044 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MDEKSSPEETGQLVYEAVMYENEELLRELLEANPGKVYYRDKHGRSALHIAAQNGNLPIL
DLLIEAGADVNSMAGPSALCATPLHVAAVAGRLEAVRHLIEAGAELLATDLRDHCALELA
QMANQFETACLLIDAIESVRNKTRQLHDDLVKSAEEGDIRTVIETLPNLTSANYDAVLNG
ATLDRKCVLHLACLNGRKEVVEALLNVRGHTLIQPNTHDTVLHAAISSQKAIIVEMILKA
FTHLVTAKNADGSTALHCASQCGSLDIVKLLLEFPYEEDVLTKIEDISGRFSYRFVLDVN
GLDAHCRTALYLAVANSYYDIVKYLLEVEFPSMDIDQKCPFEIDVYCSGGKTPLMVAAAN
GDIALVKLLVDHGADVNLPCGLTEADISSVDGARCIGSGALNEACRIGCVSLVQFLLQRG
AVDHENVALATAFKYNRDSLARLFLLRLAFVDPEYRVNKKNIDLGQMSSNRNQLSSAVYP
TTPCMLNWHNASLEAVSNDWLIAASLQVNQRLRTSRMALAALTRIDLSKNKMKILSGQLL
QLPSLRSLNAANNEITEIEVPSDGFHAPLLESLLLEFNKLSVLPDELFTNKLSMLNFLDV
SHNKLCSLPETLWSASRLRELNVSNNILSVLPAIGFLQFRPSSSLSETEQPESLYSDLYT
HQSNLSTDDSLSIGGRNDDSNITIHELKRHNIWQTSIRLARSEESDTENGPMFFSSMISV
FNVSHNNIKVMPSCLACCCPYLTRLNISHNQLTSLGPVQCLPSRLRHLDASNNQLVTAFE
RPTAVQLVCHAVNTSSNEISPMRHTSPLRNSRSRSKSAVRSQRSLSVAPAGDTLCDTFID
ACSHKQHTRLESLRTFLVANNRLTEIPLLVPSSKIISSPKKKQRESRQRCSAARRQILFP
ALTTLDVSNNFVSNVPAALSNLVSLSVLNLSGNSGIEMLPPELGLLSKLWNLILKGCSLR
DPLKSMVHVESYKTVNLIAYLKSVLEDSRPYTRLKLMIVGVQGIGKTSLLQQIRLEGTVG
KRTSPNDSWSKRMGHSTGSGGDRTAKGANISTVGVDIGEWTFEPKKTKGEPTFGPLTFRT
WDFGGQREYYATHQYFLSRRSLYILVWKVTDGETALPDLRQWLVNIQARAPNSPVIIVGT
HVDQIFSNSERFPPTYLEDLNALIRDHFVMVSDADKKGLPRVVESLFVSSKTKQNIRALC
NLLYHTAYDIRTANSKERLLDQKIPASYMALEKIVVELADERRSKGIEPVMRNSDFRATI
QERMLKNYGRAFRDDIEFNHACSFLHENGVILHYEDVTLRELYFLDPQWLCDILAHVITI
REINPFARNGLMKIDDLQVLFKSLNLNNSAINLRSHIISLLQKFEVALCWQSRSLLIPSL
LPDEYQLRGGYPGSRVLVPTRTTSWQLTVKQREAKNSLIMKASHLQMQTLFSQRNLGGKR
YRTTVPLTTILNSHEKSSASVSVGRNESGCDKGIPLIDEHRCTVNMEYLEQEVVRRIYMM
AYIPSGFWSRLMTRVLVDDHITMCMERLLEVEYLSEDSSLETLNELCDRKFLPYWLLWQT
GFEILAFEKTIFVMRQFLPLAEVRDVHYETVEWRCCAEDSNWRTLDISGSSLIEIIIPAV
RINLVSDEKEYVLRSNRAAVTRLLALIVDIMDTLLEDWYPSLGTRFVHTSEGCLLVNRLV
PCLKCASSTRNLDAFFKVKKNDDIICDSSPKHKLHAFMVEECILSAHDGVNLRCPLHFDI
SVVDIAPDTVFLDINEDYLIQPNSVKRGKLIGHGAFGFVFKAALKISDANAQDVALKMLE
PVEPGLGARVSSVSAYKAAYTKWQRDPLQNACRAYCTCRQELNVLASLQHSHITALMGVC
PRPLALLVELAPLGALNHLLNNYRRSGARLRLSVIQDTASQVAKALEYLHEHRIIYRDLK
CENVLTWRFPPPFSTITDVLVKLGDYGISRSSFPSGGAKGFGGTEGFMAPEIMRYNGEQE
YTEKADCFSFAMFLYELISLKLPFDGHEQLKEYVLDGGRPRLTPSELLYPCNVLDVMVVC
WAAQPVDRPSASQIVSMTTAPEFTHLLDVISLNDPDSAVNSSISFSTVDDVEFGSAIEDS
VEGEVWMSRSDGSVTVVSCNQYGWLDSKSIIMNTDKTVILAMCVVADNVWLAESTGILRI
YCRSSYSELWSFSISRFLPTAHLSISVISLSVFIATPLLILVTLPSALLLVKGDRITDNP
FVSSIGLSTVHSSAIIDYGQNGKQIWTGHEHSSISIYDVTLENQLVLSANICHEENQVNA
VEKSCVSHMVTAETDSALLWSVLSHGSKVYQWSTSSRMIRNRLDSRKILPSSESISTLDI
EASRDGYVSALALLDRTDGAQLYIGTSRGAVIVAQAFEMRPLAAFRPYVEDVHTIIVLDV
ASALNEYIRTRKDLISVTSLEKRSFGANSTDSGDNSLEGVSRVKDRLSETVNRFRQGTTE
RMSSLNSYVITIGNGYRCLIDRFTDRKHQGSTTLRRDSHCAIIWRTDEWVS
Download sequence
Identical sequences A0A1I9FZP8
Bm6044b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]