SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I9GD10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I9GD10
Domain Number 1 Region: 461-611,639-684
Classification Level Classification E-value
Superfamily TPR-like 1.98e-27
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 2 Region: 172-426
Classification Level Classification E-value
Superfamily HCP-like 1.44e-25
Family HCP-like 0.024
Further Details:      
 
Domain Number 3 Region: 645-775
Classification Level Classification E-value
Superfamily TPR-like 3.15e-19
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I9GD10
Sequence length 1160
Comment (tr|A0A1I9GD10|A0A1I9GD10_BRUMA) Bm1813 {ECO:0000313|EMBL:CRZ24091.1} OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=BM_Bm1813 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MAFAQPKTSVEIPLKDSTENEIIELDFDNLPDDGEEVLAILRGEHATLNFWVDLALAYYR
RGNEADFVRILEMSGSEASLEYPEYHQDQMRALDTLAAYYVIQSHKERNKDKKKEWQTKA
TLLYTTADKIIMYDTYHLLGRAYFCLLEGKIDQAEQQFNFVLNQVIFPTLGKACIFFQRK
EYRKALNCYKSVLRKMPDCPADVRLGIGYCLAKLGRLDKARLAFKRVLDLDKENVSALVA
LAILDMNTLEQEAIRRGVESFGRAYQIEQENPVVLNHLANHFFYKKELDRVEHLAWHAFQ
ITDNEAMRAESCYQLARSFHQRGNFEKAFQHYYQSTQFATANFVLPYFGLGQMYICREDY
DNAIQCFEKVLKACPTNYDTLKILGSLYAHSEPANQKERSERRKKAREIFKKVVEMCPDD
VEALIDLAQLTENCDPQGSLDAYTKASTFLSQMIEVDIPPEITNNVGSLYFTVGQYEKAR
EYFEEALKELGEVVSTGQTDLAALQTTVTYNLARSLEMLCMFDEAERLYKGILQEKPNYI
DCYMRLGCLARDKGQIYESSVWFKEGMSVNQSHADAWSLIGNLHMSKFEWAPAQKKFEYI
LKLPEYHDDPYSFVALGNIWLETLSSIHRKKEKDKDYRERALMMYSKALKVHPKNIWAAN
GIGCILAQKGAIQEARDIFAQVREATADFSDVWINIAHVYMEQKQYVAAIQMYDNCIKKF
NRHNDVSLLLYLARAHYKAGKFSECRHILEKVCAICEAPDNMMLKFNHAFVLQKLATQML
RDDKSSLEMVTGAVDDLRTAATIFEYISRNKDDTMSQARIVSRTASASEARACYDLLTQA
QTYLQRAKAQDEEEQRQRQRQEEERQALKRQQEQEAKEREEKARRELEVLKQMRQEYVEK
TKEILRLPTIVEEKRVRGSGRRRKDREGDEFVNDDSDLGDWNAGEGGELRKKKERRGRKK
RERREVSSGGSGGEIDEIESRNRREGRKSKKMRFDRNDFELSAKQKTKVKSREFVQSDES
SSDEDANKPSKSRLSDDSDDAAGSPEPVKTAESDSSAAEDAIRRTDSDDDSDNEQPKSKH
RITNNSDQSSAESSTEDRARSPSDSDDDGVEKTPMKATKRKKIVSSDEDSSENNGIAESN
AVVGDSGVDEDAGFAIADDD
Download sequence
Identical sequences A0A1I9GD10
Bm1813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]