SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J1E9E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J1E9E4
Domain Number 1 Region: 214-259,290-363
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000116
Family SMI1/KNR4-like 0.018
Further Details:      
 
Domain Number 2 Region: 29-64,91-169
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000327
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J1E9E4
Sequence length 367
Comment (tr|A0A1J1E9E4|A0A1J1E9E4_LYSEN) Uncharacterized protein {ECO:0000313|EMBL:BAV96628.1} KW=Complete proteome OX=69 OS=Lysobacter enzymogenes. GN=LEN_1141 OC=Xanthomonadaceae; Lysobacter.
Sequence
MGGSVLDWRVYGCAPSLDTFWDEPRNLGRGAAGDEAIAAVQERLGIELPAWLRSLYARYD
GGAVRMARARSRHSDDWIDADWLVPRARLLPLAEWFSLAELRRREDYRDDVFAALAADDR
RLIAIALGEDNGTLCLDYSAPGAPRIVLTDQRQRLRDYPGHIEFLADLVEIQYWNPALQA
RHDPHATLRCDPQPPSLDTFWSGPGYWAQDGAAPADEAALAAAEARLGLRLPALLRALYL
RQDGGSTEFAWVPLRRQPSWHLYDWESVVPGEAVFALAGLQTLADWAADFQGSDALYGFV
RNYAGCERLLILATHNIEWLLCLDYRERGPHDEPEVVAFEFFGELVELYRARDFHRFFAD
LRRGEIV
Download sequence
Identical sequences A0A1J1E9E4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]