SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J1GUE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J1GUE0
Domain Number 1 Region: 43-142
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.57e-29
Family Chaperone J-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 174-286
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.09e-25
Family PDI-like 0.016
Further Details:      
 
Domain Number 3 Region: 438-524
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000442
Family Thioltransferase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J1GUE0
Sequence length 546
Comment (tr|A0A1J1GUE0|A0A1J1GUE0_PLAGA) Heat shock protein DnaJ homologue Pfj2, putative {ECO:0000313|EMBL:CRG96145.1} KW=Complete proteome OX=5849 OS=Plasmodium gallinaceum. GN=PGAL8A_00336000 OC=Plasmodiidae; Plasmodium; Plasmodium (Haemamoeba).
Sequence
MKKKREYLNIADQIMNVTNVKRRKKIKIFHSILLLILSFFLSFAKGMDYYKRLGVKRNAT
KEDISKAYRQLAKEYHPDVAPDKEKDFIEIANAYETLSDPEKRKLYDMYGEDYAQSAQSE
GRGHPHGFQFDQDVVNEIFKQFAGGRAGGGGRAGNFHFKFTSGGSTFSNFQEEYEDIYKN
EVLKINSRNFESVINDITFSLVINFYSPSCSHCVSFKKKYLKLSKKFDGFVTFGVVNCQE
EQNLCRKYHVKSLPHLILMKSNKTYETFYGNRTDENITSFINKNIPYSYVEISNKKKLDN
FLMQNVDKPKVIFFVSHSNNITMLKVLSKEFEKRVNMAIIYNTNYKIMKLFKKNIKTPAI
LVVEDIDNLSGDLTQLKSFDFNILSLKLSHIVAQNRLQNNLYGHITSYQELTKKKYEAGQ
CREKDSQICFFILKLLKKNYEKFDDDIKKVASKFSSDPLKILYINVYENPYILESFGLQN
KCTYSNCLILVAFRPKRQRFRIYDGEVNVDNVHNFVENVVSGGIAINQNLTKSLKFVDNT
KYEDEL
Download sequence
Identical sequences A0A1J1GUE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]