SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J5FDI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J5FDI2
Domain Number 1 Region: 471-569
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.38e-26
Family Flavin-binding PAS domain 0.017
Further Details:      
 
Domain Number 2 Region: 400-454
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000209
Family HAMP domain 0.0054
Further Details:      
 
Domain Number 3 Region: 635-839
Classification Level Classification E-value
Superfamily PP2C-like 0.0000112
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J5FDI2
Sequence length 844
Comment (tr|A0A1J5FDI2|A0A1J5FDI2_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OIP54503.1} KW=Complete proteome; Reference proteome OX=1805211 OS=Candidatus Gracilibacteria bacterium CG2_30_37_12. GN=AUK10_00690 OC=Bacteria; Candidatus Gracilibacteria.
Sequence
MSIKNKFLLFFSIIILAFISTLTFLLFRTEEMIVKSLYNDFSQIANSTVKEIDSFLLNRI
LSLETLSHNEGIKIQMVGTDDTKNVHKKNEIKENASVEMGTGSITGTGTFDSVGVQKTST
GKVENTGKIVRKNIPMKQVLSEKENTSKILNSSIKENEDLQEVLKDFILINTDFHSVELV
SVSGQTIAYISEETLSENDAVSQKLILEKLGRDRTTKDLFVKARAGDKSYYIEDAVREDD
GNVTIDIAVPIYLEQDGKKSFIGTIIGDVNMKHIWEITDNIKIGTTGEVMLYNKSGFTIA
DRYKEKILTRPKIIVPSIQALLRGEQGETVEISEMGTEAITAYEPLLGYKEYKGLGWGIQ
VTQDTDEAFKTMRTFTLYGLLLMVAIILLVLLFVYLIHTRVSGPIIRLAQVAKEIGNGNY
LVDMENITTSISSRDEINLLAQTFRDMLLNLRTNINLMEQYKHTIDESSLVSKTDIRGII
TYANKQFCEKAQFTEAELIGKSHNIVRHPDTPKETFKNLWDTISAKKIWRGIVKNRAKDG
SAYWVTAMIAPILDINGNIFEYMSIRTDITELQNTKIQLAESFTKLQENTEALIEGKRIS
REFELAKNIQETFLPKVTSDFIPHFDTYCVVYSATEIGGDLYDIIPSTSKDEYLFYIGDV
TGHGLISGIIMAIISSLVYTFNREVGGNIQLLLSKLNNVVMARIPPKMFVTMLFMKYKPA
TKTFSYMGAGHERFLIYRKNTGKVEIMPSGGIAVGMFANMFAKDVSKEFTLASGDMLLLY
TDGITEAKNPENELFGIERLAASLEKHHEHSSAVLCDNIFADIKEFAQSDIFVDDITMMA
FGAE
Download sequence
Identical sequences A0A1J5FDI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]