SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J7HYC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J7HYC0
Domain Number 1 Region: 16-95
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.53e-28
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 196-306
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000617
Family Calsequestrin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J7HYC0
Sequence length 574
Comment (tr|A0A1J7HYC0|A0A1J7HYC0_LUPAN) Uncharacterized protein {ECO:0000313|EMBL:OIW07449.1} KW=Complete proteome; Reference proteome OX=3871 OS=Lupinus angustifolius (Narrow-leaved blue lupine). GN=TanjilG_24311 OC=Genisteae; Lupinus.
Sequence
MTRLPIWVILCFISTLLLLLLEAKTFDPYKVLGVDKNASQREIQKAFHKLSLQYHPDKNK
NKGAQEKFSQINNAYEILSDEQKRKNYDMYGDEKGNPGFEAGHHGYQGGNTYFTGGGPGG
WQGMGGQEGSKSFSFSFGGGPGGSNSFGFGLGDIFSSFFGGGGGGSRFGGGGGESRFGGF
GTSTGSQSKSKSSTKTFRAINSNIYQKEIADRGMTWLLLCYTHSSKGVQYFESTVEEVAN
SLQGALKVGSINCEKEASFCKELGVYLGRSPRLFVYSYKANGKGSLVEYDGNLAVKDLKA
FCQENLPRFSKRTDLNSLDQFSTTGKLPRVMLLSTKKNTPVIWRVLSGLYHKRFTFSDAE
VHDVSDPKVKKLGVDALPAMVGWTHNGEKHILKTGISVNDIKSAVSDLSSVLDNFEKTCK
KKASGQGKKEQTDSDDGPIQLLSQSNFEVLCGQKTPLCIIGAFRSSKAREKLDSVLSVVS
KKSLSRRPNEGASSRDSISYALLDAAKQQSFLNGLNKKGYKSSEKLLIAYKPKRGKYTVF
KGEMAIEEVESFISSVLSGDIEFRETHEKKPLLK
Download sequence
Identical sequences A0A1J7HYC0
XP_019450343.1.29932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]