SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J8PGV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J8PGV7
Domain Number 1 Region: 380-468,503-536
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000227
Family UBX domain 0.041
Further Details:      
 
Domain Number 2 Region: 201-289
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000165
Family Thioltransferase 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J8PGV7
Sequence length 558
Comment (tr|A0A1J8PGV7|A0A1J8PGV7_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:OJA07823.1} KW=Complete proteome; Reference proteome OX=180088 OS=Rhizopogon vesiculosus. GN=AZE42_03419 OC=Rhizopogonaceae; Rhizopogon.
Sequence
MDRLEAPQIEALQRLQSILGPHDTDFVVGVLESVAWDVQKATDLLFDNEEVAATRTTAVS
QLDSSTAVSQFELEDSSLPTPTRHPHPGRGSPRSSWNLLWSLLAVPLHLVSGVLRFLFGI
LRIPIPSLPFMTTSYPSLRSGPSDSRSITQRWVQELEEETGACSSKRSMPNAVSTGFEAG
PSTTTRHTYPPAAVEDNPKILPDFFDGSYEDVIDICQKEGRVACVILVSAEHDDDAEFKR
STLTDAAFVKVLLDNDFIVWGGDIRDKAAWDASQKLQATTYPFVAFLALQPRRHAGSSNS
APVVTILSRHQGRTATTSATLIEHLNTQLLPRVSPFLVRFKTALQDRDRDRRIREEQDRA
FRETARRDREAIEARMRQEKEEEERARKHAEEMMRKQENSERQRQQAGIRMEWRKWIRKH
LLLPEARGLRLAIKLPGNGRVVRSFPSSATLTSLYAFADSQLIPSTCPPEDDPSQAPEGT
VDSIPRLDSYIQNQTAGHAWWGFTLASAYPRREFRWKANTLLTQIGVTNGEQIVMEFITG
HKPSGEHDSDDEYESESD
Download sequence
Identical sequences A0A1J8PGV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]