SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J8QKY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J8QKY4
Domain Number 1 Region: 249-425
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.52e-31
Family Glutathione peroxidase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.71e-28
Family PHBH-like 0.0001
Further Details:      
 
Domain Number 3 Region: 100-190
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.39e-19
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J8QKY4
Sequence length 430
Comment (tr|A0A1J8QKY4|A0A1J8QKY4_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:OJA21319.1} KW=Complete proteome; Reference proteome OX=180088 OS=Rhizopogon vesiculosus. GN=AZE42_03879 OC=Rhizopogonaceae; Rhizopogon.
Sequence
MDGEQTDFIWGVVDIIADTDFPDIRYGSAIHSESGSCLIIPREGEKVRFYIQLSDSDVKD
PITGRVDKNRMSPEKLLEVARKIIHPYKVHEPKLYDWWTVYIIGQRVASRYSVNERIFIA
GDACHTHSPKAGQGMNASMSDTHNLAWKLVQVLRGRADISLLKTYELERRKYAQDLIEFD
RKISTLFSGKPKTADNDDGVSHEEFLKSVLRKSSELPWLTVNSAFQIYGGFITGIGVHYV
SSGITNEIHQQCAPHLIIGERMPPQVFIRAADARPYEIQDMLPSDTRFKLLFFVGYVTEE
RVGELDALFDKLRDPSCFLQKYGYPTEGIAQSMFSIITIMSGDKENVEFTQVPELFRPHW
SNVLLDDTDTTKKIGGGACTRFGIDPMTVTLVIIRPDGYVGMIAPASALEDVDSYFATFA
IPRKAVLGRD
Download sequence
Identical sequences A0A1J8QKY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]