SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J9U9J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J9U9J4
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.19e-35
Family SMI1/KNR4-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J9U9J4
Sequence length 150
Comment (tr|A0A1J9U9J4|A0A1J9U9J4_9BACI) Spore coat protein {ECO:0000313|EMBL:OJD75454.1} KW=Complete proteome OX=1866316 OS=Bacillus sp. NH24A2. GN=BAU28_16905 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MNEKIISIITTYQKLGDFMGSANEDTIQQAAQILNISFPSSYHWFLKQYGSGGLDGIEIH
GCESTAVDSSVVYHTKLYRETYDLPLHYIVLNDIDGTVTCLDISQMKNGECPVIFWSRFS
KELYAVTYGNFRDYLLDSLQETVDNLYNED
Download sequence
Identical sequences A0A0J6KK42 A0A1J9U9J4
WP_048376745.1.100231 WP_048376745.1.71247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]