SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L0FU73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L0FU73
Domain Number 1 Region: 131-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000447
Family UAS domain 0.051
Further Details:      
 
Domain Number 2 Region: 329-431
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000171
Family UBX domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L0FU73
Sequence length 445
Comment (tr|A0A1L0FU73|A0A1L0FU73_9ASCO) CIC11C00000002647 {ECO:0000313|EMBL:SGZ47831.1} KW=Complete proteome; Reference proteome OX=45354 OS=[Candida] intermedia. GN=SAMEA4029010_CIC11G00000002647 OC=Clavispora/Candida clade.
Sequence
MNWQSSIFGFRLGSQDNSESNSSTNLPGHFPSDQEAQNQGSSARVTFNTISGTVNYIVIK
PITVILTIALGIFGRFLSLLYFRDLLHVRSTSVNNALINDPIRRVEQFVLDLEENLLPQQ
QFSTHHSDHSVALPPFFQGSYTQALYMATSRGKFLFIYLTNPQNDGALSIFQRIVTNQKF
ISMFTSDNDQNIIWGADVTNPEAYQLANSLNITKFPVLGLLCLARTTTMTPEGPKKTAPR
ISLILKIQGGLPDGQDADALIYSKFIKRMMKYEPELALIRSELREKYISDMMRRKQDMDY
NQSLLRDQQKKLERERKALGDKYLSWRQPQFYDLMNSNDRVDKAKIAIRMADGSRETVLF
PKDGPIEDVFVFVELKNRGMLNDRLQSNVSVQEAHELFDDFHMSFDFNLVSSVPPRPCLN
DLSPQTTIEQVDYIYPSGLLMVDAK
Download sequence
Identical sequences A0A1L0FU73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]