SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L1RK81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L1RK81
Domain Number 1 Region: 23-217
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.45e-52
Family Astacin 0.0000273
Further Details:      
 
Domain Number 2 Region: 331-443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-37
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 3 Region: 224-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-31
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L1RK81
Sequence length 445
Comment (tr|A0A1L1RK81|A0A1L1RK81_CHICK) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN= OC=Phasianidae; Phasianinae; Gallus.
Sequence
GSEIAVYEGDILLRRGQRSAINCESCLWPKSQDGLVKVPVNISSDFSLAERSWIADALQE
VSTLTCVKFVNRTTETDYVYVERGQSCWSYFGKIGGRQAVGLVKNGCMDKGAIQHEMNHA
LGFIHEQARSDRDKFVKIMWEHITAGEQGNFGKVNSKNLGLPYDYSSVMHYGAYDFSSTP
GKPTIVPVPNPLVPIGQREGLSNLDVAKINKLYKCNCCSSVLPKTKGSFSSVNYPSPYPN
NSNCLWLIRIRRNKIFLQFEDFDLQTSSDCSSDYVKVYSGNSKNSPVLLDKYCGQGPLPS
IVASGPTMLVEFASDETVTATGFRASYSRVNCGGTFTDSSGVITSPNYPNKYPKNRACFW
VISSPVGYKVSLKMLFFELEDNDRCIYDYLLIHDGSRPTSPAAGPYCGTNKVADFTSTAN
FVLVEFHSDAVWELPGFKLSYTFHR
Download sequence
Identical sequences A0A1L1RK81
ENSGALP00000032014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]