SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L1RW02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L1RW02
Domain Number 1 Region: 270-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.06e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000202
Further Details:      
 
Domain Number 2 Region: 426-583
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000201
Further Details:      
 
Domain Number 3 Region: 636-793
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-32
Family MAM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 24-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-32
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 5 Region: 144-261
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-32
Family Spermadhesin, CUB domain 0.0000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L1RW02
Sequence length 914
Comment (tr|A0A1L1RW02|A0A1L1RW02_CHICK) Neuropilin {ECO:0000256|PIRNR:PIRNR036960} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=NRP1 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MDWGLFLHCAALTFTLSRALRSDKCGDTIKILSPGYLTSPGYPQSYHPSQKCEWLIQAPE
PYQRIMINFNPHFDLEDRDCKYDYVEVIDGDNAEGRLWGKYCGKIAPPPLVSSGPYLFIK
FVSDYETHGAGFSIRYEVFKRGPECSRNFTSSSGMIKSPGFPEKYPNSLECTYIIFAPKM
SEIILEFESFELEPDSNTPGGAFCRYDRLEIWDGFPDVGPHIGRYCGQNNPGRVRSSTGI
LSMVFYTDSAIAKEGFSANYSVSQSSVSEDFQCMEPLGMESGEIHSDQITVSSQYSAIWS
SERSRLNYPENGWTPGEDSVREWIQVDLGLLRFVSGIGTQGAISKETKKEYYLKTYRVDV
SSNGEDWITLKEGNKPVVFQGNSNPTDVVYRPFPKPVLTRFVRIKPVSWENGVSLRFEVY
GCKITDYPCSGMLGMVSGLIPDSQITASTQVDRNWIPENARLITSRSGWALPPTTHPYTN
EWLQIDLGEEKIVRGIIVQGGKHRENKVFMKKFKIGYSNNGSDWKMIMDSSKKKIKTFEG
NTNYDTPELRTFEPVSTRFIRVYPERATHAGLGLRMELLGCELEAPTAVPTVSEGKPVDE
CDDDQANCHSGTGGTTVLNTEKPTVIDNTVQPELPPYNLNCGFGWGSHKTLCQWEHDNQV
DLKWAILTSKTGPIQDHTGDGNFIYSQADESQKGKVARLLSPIIYSQNSAHCMTFWYHMS
GPHVGTLKIKLRYQKPDEYDQVLLSLNGHQANCWKEGRVLLHKSVKLYQVVIEGEIGKGN
GGIAVDDINIDNHISQEDCQKSTDVESEIVEEDPESNQTGFTPSYRTDEDYDDISRKPGN
VLKTLDPILITIIAMSALGVLLGAICGVVLYCACWHNGMSERNLSALENYNFELVDGVKL
KKDKLNTQNSYSEA
Download sequence
Identical sequences A0A1L1RW02
ENSGALP00000011550 ENSGALP00000011550 9031.ENSGALP00000011550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]