SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L1RWW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L1RWW5
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-21
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 2 Region: 228-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000152
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 340-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L1RWW5
Sequence length 549
Comment (tr|A0A1L1RWW5|A0A1L1RWW5_CHICK) Thrombomodulin {ECO:0000313|Ensembl:ENSGALP00000063331} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=THBD OC=Phasianidae; Phasianinae; Gallus.
Sequence
MRRLLLPLLLAGLGLGLGLVLGLGEPEPPAPSGAQCLEHDCFAVFWTPGPFAAASAACER
HGGHLMTVRSTVAEDAIELLLRKRGGRLWLGLRLPTLCTEPARRLRGFQWVTGDTGTDYD
NWVPSGRRCGQLCVTVSRELSWEERRCDEPADGFLCEYNYPDSCPRLSPSDGASLTYRTP
FGAAGGDFLALPHGSTAFVSPMGLQLLCEAAADSGKMRWGRSEPGAWPCRLDNGGCEGSC
EELDGTPSCACPAGKKLGPDGRSCVSPCAGAPCEQHCVPDGEGFHCMCSEGYELGPDGSS
CQDVDDCVKVPEVCEQVCYNTEGGFECHCHRGYEMVEGHCKPISSCSTGPCDHTCEDVPG
GYQCSCYNGYVVNPKNPTECLQKCEDGRCLAECDASGLYCVCPEGFLLDHLPNGVSLCVD
IDECESNHCEHNCTNTAGSYICHCQPGYMPFDVNHCIPISQEDNEDGYSGDSGPPWPVPS
HIPPKAEHLHPGALVGITMGVLCAALVLLAVGYHLARKRCHPPSSMEYKCGSPREKEMGL
QQVSASQKV
Download sequence
Identical sequences A0A1L1RWW5
ENSGALP00000013601 XP_004940194.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]