SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L5JRX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L5JRX1
Domain Number 1 Region: 39-256
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.66e-118
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000648
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0000000000000153
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L5JRX1
Sequence length 256
Comment (tr|A0A1L5JRX1|A0A1L5JRX1_9ARCH) Methyl coenzyme-M reductase subunit A {ECO:0000313|EMBL:APO18207.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
GMSFIAAYNMCAGEAAVADLAFSAKHAGLVSMSEMLPARRARGPNEPGGLSFGHMADIIQ
TSRVDKKDPAHVALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTNNILDDNTYHDV
DYINDKYGGAANLGTDNKAPATIETVKDIATESTIYGLENYEKYPTVLEDHFGGSQRATM
LAAASGVSTALATGNGNAGLSAWYLSMYLHKEAHGRLGFFGYDLQDQCGATNVFSYQSDE
GEPLELRGANYPNYAM
Download sequence
Identical sequences A0A1L5JRX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]