SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L7JN60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L7JN60
Domain Number 1 Region: 1-211
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 5.36e-87
Family Clostridium neurotoxins, "coiled-coil" domain 0.00000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L7JN60
Sequence length 212
Comment (tr|A0A1L7JN60|A0A1L7JN60_CLOBO) Clostridium neurotoxin, Translocation domain protein {ECO:0000313|EMBL:APU87211.1} OX=1491 OS=Clostridium botulinum. GN=NPD8_4101 OC=Clostridium.
Sequence
MDYIKTANKVVEAGLFAGWVKQIVDDFVIEANKSSTMDKIADISLIVPYIGLALNVGNET
AKGNFENAFEIAGASILLEFIPELLIPVVGAFLLESYIDNKNKIIETINSALTKRDEKWI
DMYGLIVAQWLSTVNTQFYTIKEGMYKALNYQAQALEEIIKYKYNIYSEKERSNINIDFN
DVNSKLNEGINQAIDNINNFINECSVSYLMKK
Download sequence
Identical sequences A0A1L7JN60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]