SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8F463 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8F463
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-31
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000916
Further Details:      
 
Domain Number 2 Region: 208-315
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.45e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000323
Further Details:      
 
Domain Number 3 Region: 375-434
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000876
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L8F463
Sequence length 446
Comment (tr|A0A1L8F463|A0A1L8F463_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT66357.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18042614mg OC=Xenopus.
Sequence
MPFRYWHRQSCVTLATTVVQLLVAQGRDWWTKQFVGVMCLVKDNPRRSYFFQLFDLRAEK
MVWEQEIYEQLNYNTPRLYFHTLCSNDCQTGLNFADEVEAAAFQLVIEEKLKKKQHRQDR
RQNLPPPPPVSDDRRTSLPLPLPPGPFPNGPTSPLPLAPSQSLNMPAVNIPNPDVTSARY
RALTAPADKGKNKKGKKKFSKADIGAPSGFKHVSHVGWDPNSGFDVNQLDPDIHDLFSRA
GISDAQLEDAETSKLIYDFIEQQGGVEAVKQEMRKGEPIPPPPPPSRNAPPAPSQSRGRT
GPLPPPPVRGSSAPPLPPPSRSTPPTPPPTVRSGGPPPPPPPPPPSAPALPATGGPAPPP
PLPVSQSTPSAAPSGGRGALLDQIRHGIQLNKVTDSAEPPLSPQPSTEGLVGALMHVMQK
RSKAIHSSDDDEEDGADDDDDDEWDD
Download sequence
Identical sequences A0A1L8F463
XP_018087247.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]