SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8F464 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8F464
Domain Number 1 Region: 29-138
Classification Level Classification E-value
Superfamily PH domain-like 4.04e-33
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000614
Further Details:      
 
Domain Number 2 Region: 234-341
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.41e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000323
Further Details:      
 
Domain Number 3 Region: 401-460
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000994
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L8F464
Sequence length 472
Comment (tr|A0A1L8F464|A0A1L8F464_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT66358.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18042614mg OC=Xenopus.
Sequence
MSRGGPKMGARLQDNISSSLLLPQENQKLFQLLGRKCTTLATTVVQLLVAQGRDWWTKQF
VGVMCLVKDNPRRSYFFQLFDLRAEKMVWEQEIYEQLNYNTPRLYFHTLCSNDCQTGLNF
ADEVEAAAFQLVIEEKLKKKQHRQDRRQNLPPPPPVSDDRRTSLPLPLPPGPFPNGPTSP
LPLAPSQSLNMPAVNIPNPDVTSARYRALTAPADKGKNKKGKKKFSKADIGAPSGFKHVS
HVGWDPNSGFDVNQLDPDIHDLFSRAGISDAQLEDAETSKLIYDFIEQQGGVEAVKQEMR
KGEPIPPPPPPSRNAPPAPSQSRGRTGPLPPPPVRGSSAPPLPPPSRSTPPTPPPTVRSG
GPPPPPPPPPPSAPALPATGGPAPPPPLPVSQSTPSAAPSGGRGALLDQIRHGIQLNKVT
DSAEPPLSPQPSTEGLVGALMHVMQKRSKAIHSSDDDEEDGADDDDDDEWDD
Download sequence
Identical sequences A0A1L8F464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]