SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8FGH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8FGH3
Domain Number 1 Region: 367-489
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 193-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000113
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 241-361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 159-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000311
Family EGF-type module 0.034
Further Details:      
 
Domain Number 5 Region: 119-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L8FGH3
Sequence length 1617
Comment (tr|A0A1L8FGH3|A0A1L8FGH3_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT70699.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18037622mg OC=Xenopus.
Sequence
MLPTMCVQMMMMMPFLLLLLLPLEMCSATDGIHLQPYMPNVCSVKEPSIAAHKQPVIQAF
SRMVKVWKQGCAGQVWCVGYERRTAYYITYRTVYSMDYKSVNKCCPGWSQRNGETGCHYM
ACTTGVCFNGGNCADGSSQQCFCPAGFQGPRCQYDVNECENNNGGCDVQCCNTIGSFYCK
CSDGHSLKEDGKTCQDVDECQTHNGGCQQKCVNTPGSYHCECKPGFRLHIDSRSCIPVFS
CSVANGGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHCELTNPCSSRNGGCMHQCNNDGGL
VRCSCHPGYKLSADGKSCEDINECLTGLAMCAHSCLNTRGSFHCGCSPGYELGADGKQCY
RIEMEIINSCEINNGGCSHQCKHINAGPLCLCPQGFELDLDGKTCIDTDECTNGASCCQQ
ECSNNPGGYECLCYPGYRLNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCSPGYRL
DGDSKSCVAITNQVDPDQRPIVRSLPQVTLLRDEFAQFFDDDYDDEEAEARGEHTLSESF
VCFGGSFGPDCTLTCDDCKNRGTCNDEEDGCVCQEGWTGLICNQTCPEGTFGQNCSLKCN
CKNGATCDPITGKCRCPQGVSGEFCEEGCPKGYYGKTCKKKCNCASKGRCHRIHGACLCD
PGLYGRYCHLACPKWTYGPGCSEECQCVPKNTLECDKKEGLCTCKPGFHGEHCQKKCDVG
FYGIGCKSKCSCPHGVLCDHTHGKCQKQCPEGHQGDNCDQECPEGTFGLSCLKTCACGGA
PCNHVSGMCICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENDGSCNPATGECTCAPGYT
GSLCKEICPAGWHGQGCQMRCACQNNGQCDPISGRCTCPPGWTGHNCRRACDAGYWGTDC
LNPCNCSNSDGSCDSVTGQCICESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVS
GACTCAAGWRGTFCELPCPDGFYGTDCAIHCRCSNGAHCDHVTGSCTCLAGWTGTTCSQK
CQENRYGNNCEETCNCFNGASCNHINGECMCSPGWTGITCRQACSDGYYGLNCVQQCICG
NGGKCDHVMGRCSCQKGWTGLACEIECTPGTYGDGCLQNCTCQNGGVCERETGRCMCHAG
WTGELCQTACPAGTFGVKCAERCNCRHGVSCNHITGMCDCSAGWRGKHCDKPCLPGSYGE
KCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHP
VTGECVCAPGYHGANCQLKCSNGLYGPNCEKRCMCKNGGHCEATTGMCHCPAGYVGSDCS
TVCPSGRYGKGCAHICRCGPRSSCNHVTGECICPPGRTGQNCGHLCSRNYFGKDCKHRCT
CKNGGMCNPVDGSCTCGLGWQGPTCEEGCPAGKYGAGCQMECSCQSNGTCDMVTGACHCL
KGYYGTKCEHACPPGFHGDNCGELCTCENGATCDPVTGMCLCPAGFYGDKCEKGCEKGTY
GDKCNRLCECEENAPCDSETGECICPPGRTGASCDLECRIDRFGPNCTFSCECSWNSQCN
SMNGGCMCLNGFIGPTCREGGPPQLTSTLFQTLLYAKSQAQSGSSTRYLINASKQRP
Download sequence
Identical sequences A0A1L8FGH3
XP_018083491.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]