SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8FML6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8FML6
Domain Number 1 Region: 361-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 187-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000656
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 3 Region: 234-355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 148-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 113-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000664
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L8FML6
Sequence length 1613
Comment (tr|A0A1L8FML6|A0A1L8FML6_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT72833.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18035815mg OC=Xenopus.
Sequence
MLPTMCVQMMAFLLLVLTQEMCSATDGIQPYMPNVCSQREPSVAAHKQPVIQAFSRMVKV
WKQGCAGQMWCVGYEKRTAYYITYRTVYSMDYKSVNKCCPGWNQRNGETGCHYMACTTGV
CFNGGNCADGSSQQCFCPAGFQGPRCQYDVNECENSNGGCEVQCCNTIGSFYCKCSDGHS
LKEDGKTCQDVDECQTHNGGCQHRCVNTPGSYHCECKPGFRLHSDSRSCIPVYSCSVANG
GCEHDCVQVTVAHYQCRCRHNYQLKEDGKHCELTNPCSSRNGGCMHQCNNNGGLVRCSCH
PGYKLSADGKSCEDINECLTGLAMCAHSCLNTRGSFHCGCSPGYELGADGKQCYRIEMEI
INSCEINNGGCSHQCKHINAGPLCLCPQGYELDLDGKTCIDTDECTNGASCCQQECSNNP
GGYECLCYPGYRVNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPPGYRLDGDSKS
CTTITNQAEALPGQRPIVRSLPQVTLLRDEFAQFFDEDYDDEEAEARGEHTLSESFVCFG
GSFGPDCALTCDDCKNGGTCNDEEDGCVCQEGWTGLICNQTCPEGTFGQNCSLKCNCKNG
ATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCASKGRCHRIHGACLCDPGLY
GRYCHLACPKWTYGPGCSEECQCIQKNTLECDKKEGLCTCKPGFHGEHCQKKCDVGFYGI
SCKSKCSCPYGVLCDHTHGKCQKQCPEGYQGDNCDQECPEGTFGLNCLKTCACGGAPCNH
VSGMCICPAGKIGIDCAKGCPVGHWGAGCQEICPMCENNGSCNPATGECTCAPGYTGSLC
KEICPAGWHGQGCQMRCACQNNGQCDPISGRCTCPPGWTGHNCRRACDAGHWGTDCLNPC
NCSNSDGSCNSVTGQCICESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACT
CAAGWRGTFCELPCPDGFYGTDCANHCRCSNGAPCDHESGSCTCLAGWTGTTCSQKCQEN
RYGNNCEETCNCFNGASCNHISGECVCSPGWTGITCRQACADGFYGFSCLQQCICRNGGK
CDHVSGRCSCQKGWTGLACEIECTPGTYGDGCLQNCSCQNGGVCERETGRCMCHGGWTGD
LCQTACPAGTFGVKCAERCNCRHGVSCNHITGMCDCPAGWRGKHCDKPCLPGSYGEKCVE
LCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHPVTGE
CICAPGYHGANCQLRCSNGLYGPNCEKRCSCKNGGHCEATTGMCHCLPGYVGSDCSTVCP
HGRYGKGCAHVCPCGPRGNCDHVTGECICPPGRTGQNCEHMCSRNYFGKDCKHHCTCTNG
GRCNPVNGSCTCGLGWQGPTCEEGCPAGKYGAGCQMECSCQSNGTCDIVTGTCHCLKGYY
GATCEHACPPGFHGDNCGELCTCENGATCDPVTGTCLCPAGFYGDKCEKGCEKGTYGEKC
NRLCECEGNAPCDSVTGECICPPGRSGASCDLECRIDRFGPNCTFSCDCSWNSQCNSMNG
GCMCLNGFIGPTCQEGGPPQLMSTLFQTLLYAKSQTQSGSSARYLINTSKQRP
Download sequence
Identical sequences A0A1L8FML6
XP_018081644.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]