SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8FMM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8FMM1
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000319
Family Glutathione peroxidase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L8FMM1
Sequence length 201
Comment (tr|A0A1L8FMM1|A0A1L8FMM1_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT72846.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18035825mg OC=Xenopus.
Sequence
MGSLDLAKAGAILVKNALSGEMVELKSLWKEQTTVLLFLRRFGCQICRWIAKDMGKLKES
CDVHQIRLVGIGPEEVGLKEFLDGNFFNGELYIDDSKQSYKDLGFKRYSALSVIPAALGK
KVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLLHFIQDSPGDYVPLETIVQTL
GITANVTESQRPQCNDDVCTR
Download sequence
Identical sequences A0A1L8FMM1 Q6AZG8
NP_001087128.1.7800 gi|148231275|ref|NP_001087128| gi|50604018|gb|AAH78028| gi|82181988|sp|Q6AZG8|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]