SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8FPW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8FPW7
Domain Number 1 Region: 1692-1749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000113
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 1593-1645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000389
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 42-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000207
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1565-1604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000212
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 1734-1786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000991
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 1656-1706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000036
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 1334-1373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000372
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L8FPW7
Sequence length 2154
Comment (tr|A0A1L8FPW7|A0A1L8FPW7_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT73623.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18032585mg OC=Xenopus.
Sequence
MQGKERSTTALDGCVTTRQRLSSATNQDPDVALGSASDTGQYLCMECSETFSSKVQLSSH
RQSHVAKKPFMCSYCGRGFHHQIFLQVHERSHEGGATSHQLTAVKPGASRVISTRSCRTV
APLTSDCVNVQPIPSKPELLLNSLVQFRKGHGSQQSPAPIECVTRLSRSQAQPCAQRKDS
AEKRSPIELRVSRFSDTTVHLMDAFGNSIELLTEVFSTYTMNGPKQNPATHVPSSVDSTP
CEQRTDRTQQEKNDGETLTSNNLQSHMPPQLVPHTDTPTVCPIETDVGKMESDFSPGAVV
CSAAPYITTSETPMHNESERLTSGDPELPIETLDDPIETLDDPIETLDDPIEALDDPIET
LDDPIETLDEPIETLDDPLSKGTEPISVPHVITYQVSTELDSPLDGITVSSPPTYSQSVL
PSKGHDGPGTNSTEQTDSVPEMDSLEETHNFLVPYEQKQKGSLLAEVTSVLQAEDVRVPG
TAQAGGLPEYQQRAAPTDHSEQVGEIDACSVGISTLRTDIAMTSELDSQSDVGNGDHKIV
LGQSTQSGVKGVSLVPVNIKQLPSHETAIDLKLSLVQDAHSAATVQGTNCSRGTETTSAN
VGVGHQHGQDLHCERNAQPVMVYNKAEDGSFPKPHPETGAGDASEMEAAENDQAPPTKKD
DYKLIHTNSAASLCDQEPTVPESQDKDDQVSATYRHGQDLRSQEPDRTHAESLDPAIVDH
DYSDLRRTLKDTPVLCSPITVEMAREFGDGQCDESHIVAGIHDAPPIGEKNNAQHGEQEQ
HLLDKRPDLQEGISGNVEKFAESGTAETALILSKDGEPQAMGDLHPHDIMDSTLTGPQPE
RAECKEDISRWVSSMEASLQEKGVAHETEKGTNTHIGPLAAFIPSSHHNETELNCVAKRS
LCKSAPTERKEENKADVALSPSVTNEVELEGTVPCLTCGQHVNGNKSPSHVCSNFSKSSM
TVMESKRIEMIPADVKRDLDSITEPPSLEPEEPDAKVNKMYNCPKCDKTFRLPVLLAGHV
KCHSSHLCITCGSPMPHKYKMKRLARKCQQCIQNTIVKRQEKRLLSSHYSEEEDMVTSGT
GFSTELNEEADLTLSCAPNTEDVLGANSAIELTQPKRPCIKQRAKSADGSLGMEPSIECS
EVRKKRGRQPAKGDVIPATVPKVYKCLQCGVSFLQCMFIVKHMKEHSMTQTQPCKCYLIV
RRGGKQTLKQCKICREHTKSTALDASQLTGSASEQNLHIHTLGPKKIIKRVRKGDVPFQR
PGDKKIPLKQRKYGRKSMAPVRECHDEPHLEKKSQIPPLDGNAELMSTNWEESIGEQSVS
GRGTDKRSEDLLLKPHVCDVCSKAFRLPRYLRLHSVSHTGTLCASCGCLFRYKRRAGRPS
KKCRLCRMKGRERRVLSKTILEPNLPELPKAHKAEVLSSLPHGKQSKILAKLKAPIQAKL
SEAFKKKKFKLLKGPQGHSKKRKLNSMQLEKRKKKLKSIEDLSPPTPKKRGRPPGKPTAH
RMLSTVNSPAIKSEGTSVAVSDDGLHPIETTKNNFSGDGKSDEVPTYQILPTMSIKEEPN
SSEISSFQCSECGQNFPYKHLLDNHMQTHTGDRPYVCSDCDKCFAKINHLTIHKRVHTGV
RPHVCSVCQRSFRQKSSLLAHRYTHTNQPPLLVTSYECSVCLKEFKQNSDLEAHECILPV
ELPVQCKDCNRVFTNKGRLAVHSRVHTVQTSYPCPICNRSFIYKANLERHQQKHKGEKPF
SCAKCGVSFARRKTLERHKLAHGKKGLFSCIHCKKYFLLQTWLFRHLKICQGVNKGKVLK
VQKRKKIKEDVEVSSTVSSEEAEKKIIKVENKEQKIKKIMKSKVLGEAKLKSKAAEGSKE
EKLKVKATKAEKGTLKKKLTEGGQEKGEGSSVEEEKKPNEQDNEKKGNKQEQIKKGQREF
PERANTSDGKPKAKCAAPAKKELLSEEKQKAKSAKKDMLGEEKQKAKGAKKNMLGEEKQK
AKGAKKFMLEEKQKAKGAKKNILGEEKQKAKGAKKDMLREEKQKPKGAKKHMLGEEKQKG
ATTAKKESNGEEKQNVKVAAPTNFELLGEEKLIGKGATTTKKESEEEEKQKARNVIPAKK
ELIGDEKQKTKGTPPAKKPRLESYPKVATPERMRKEDGKGKEPQGKLQSGTGKK
Download sequence
Identical sequences A0A1L8FPW7
XP_018079545.1.7800 XP_018079546.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]