SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8GM10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8GM10
Domain Number 1 Region: 527-573
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 2 Region: 101-137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 45-92
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000942
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 483-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000229
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L8GM10
Sequence length 573
Comment (tr|A0A1L8GM10|A0A1L8GM10_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT84869.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18023028mg OC=Xenopus.
Sequence
MFLYWGFLLYFSLHFCSCETEANATKTTLDQKRWRRSVANPPQPIECEFSNWSDWSSCDP
CQKKRFRYARLTQPAQFGGDPCNRIDRQEDPCASRNPCRNTKTCEGFRCTETGRCIVRRL
LCNGDDDCGDLSDEKNCKSVPSSCSTNEMEQYWGIENLASGINLFTNNREGFVLDHRYYA
GGCSPHYILNTKFRKPYNVENYIPESKGKYEFSLSEHESYSDYERNFASRHAKQTSFSIG
LKIPGLFEFGFNYNDMKVKTFIERTKKFSHTKSKFISAKSTLEVAQYKVKSRNLMLHTEF
FQRVKQLPMEYVYGEYRDIFRDYGTHFITEATLGGVYEYTLILNSEKLQKEGYSLNDVQK
CVQAGLKLGVTIEGISLSVGMSGGACSGLLKEIGDKISSDKLVEDFVALVRGGASEHIAA
LAYKDLPTQDLMQEWGDAVYYNPEIISMKASPLYELVTATDFTGANILQENMKRALEEFQ
AETSPCRCVPCQNNGLAIFTENRCECICPLGFSGAACEITKRPVNAIDGSWSCWSGWTPC
SRRIQTRDRQCNNPSPQNGGNQCEGTNTDSRSC
Download sequence
Identical sequences A0A1L8GM10
XP_018113770.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]