SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8H0D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8H0D7
Domain Number 1 Region: 521-890
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-126
Family Hect, E3 ligase catalytic domain 0.00000000485
Further Details:      
 
Domain Number 2 Region: 20-155
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-29
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 
Domain Number 3 Region: 465-505
Classification Level Classification E-value
Superfamily WW domain 0.000000000000131
Family WW domain 0.0002
Further Details:      
 
Domain Number 4 Region: 344-383
Classification Level Classification E-value
Superfamily WW domain 0.000000000000334
Family WW domain 0.0015
Further Details:      
 
Domain Number 5 Region: 184-224
Classification Level Classification E-value
Superfamily WW domain 0.00000000000417
Family WW domain 0.001
Further Details:      
 
Domain Number 6 Region: 418-453
Classification Level Classification E-value
Superfamily WW domain 0.00000000000542
Family WW domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L8H0D7
Sequence length 897
Comment (tr|A0A1L8H0D7|A0A1L8H0D7_XENLA) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18018180mg OC=Xenopus.
Sequence
MMASSMEVLGVQAEEEGVRILRVKVIAGIGLAKKDILGASDPYVKLTVYDPADGILSSVQ
TKTVRKTLNPKWNEEILFRVYPQKHRLLFEVFDENRLTRDDFLGQVDVPLHQLPTEHPRL
ERPYTFKDFILHPRSHKSRVKGNLRLKMTYLPKNNGSEDDTEQAEEMEPGWVILDQPDTS
CQPQLQQELSPLPPGWEERQDILGRTYYVSHQYRRTQWQRPTIQDDTAANESRNVQLEEQ
HHHAFTTRRQISEETEASESRESPESWEIITEDETTVYSIQNAQQQSAPSSDAQAQITEE
LSIRLNISGNMPNSRQSSSNVHSNRRESLQSYTSEELPTLPVLLLPTSSGLPPGWEEKQD
DKGRSYYIDHNSRTTTWEKPIVQGPMETSQASSVQNVPVICQPQRSTSESAQLSETEQGF
FPKGWEVRHAPSGRPFYINHVTKTTTWEDPRFKIPVQLRPKPPIDLSDLGPLLPGWEERT
HTDGRVFYINHNTKQTQWEDPRLQTVAITGPAVPYSRDYKRKYEYFRKKLKKQLDIPNRF
EMKLRRTSILEDSYRRIVAVKRPEFLKARLWIEFDNEKGLDYGGVAREWFFLISKEMFNP
YYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKM
MLQKPISIYDMESVDSEYYNSLQWILENDPTDLDLCFTVDEELFGQTHQHELKAGGSQIL
VTNKNKKEYIHLVIQWRFMDRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDV
DVNNWREHSKYKNGYSQGHQVIQWFWKAVLMMDAEKRIRLLQFVTGTSRVPMNGFAELYG
SNGPQLFTVEKWGTPEKLPRAHTCFNRLDLPPYESFEDLWDKLHIAIENAQGFDGVD
Download sequence
Identical sequences A0A1L8H0D7
XP_018108539.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]