SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8H859 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8H859
Domain Number 1 Region: 155-270
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.36e-25
Family Glutathione peroxidase-like 0.0006
Further Details:      
 
Domain Number 2 Region: 36-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000218
Family Glutathione peroxidase-like 0.0036
Further Details:      
 
Domain Number 3 Region: 286-412
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000105
Family PDI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L8H859
Sequence length 414
Comment (tr|A0A1L8H859|A0A1L8H859_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT92294.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18015350mg OC=Xenopus.
Sequence
MSGPGLLVELLGEKLVNSEREEADVQALGSRVSLIGLLFGCGMSAPCLQLLPGLKDFYCK
TRDRLEIVFVSSDPDQKKWQLFVKDMPWLALPYQEKHRKLKLWNKFRISNIPSLIFIEAS
TVKTVCRNGLLLVKDDPEGLEFPWGPKPFCEVIAGPLIRNNSQSQESSTLEGSYVGIYFS
AYWCPPCRSLTRVLVESYRKIKESGQKFEIVLVSADRSEESFKQYFSEMPWLAVPYSDEA
RRSRLNRLYGIQGIPNLIILDPKGEVITRQGRVEVLRDIDCKEFPWHPKPVVELTELNAV
QLNEGPCLVLFVDSEDEGESEAAKQLIQPIAEKIIAQHKAKDEDAPLLFFVAGEDDMTDS
LRDFTNLPEAAPLLTILDMSARAKYVMDVEEITPEIVQSFVTDFLAEKLKPEPI
Download sequence
Identical sequences A0A1L8H859 Q6GM16
NP_001086161.1.7800 gi|148234401|ref|NP_001086161| gi|49256234|gb|AAH74275| gi|82183968|sp|Q6GM16|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]