SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9B0C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9B0C4
Domain Number 1 Region: 12-317
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-49
Family Ankyrin repeat 0.0000748
Further Details:      
 
Domain Number 2 Region: 349-402,429-504
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.23e-17
Family SMI1/KNR4-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L9B0C4
Sequence length 512
Comment (tr|A0A1L9B0C4|A0A1L9B0C4_9DELT) Uncharacterized protein {ECO:0000313|EMBL:OJH35717.1} KW=Complete proteome OX=83449 OS=Cystobacter ferrugineus. GN=BON30_37310 OC=Cystobacterineae; Archangiaceae; Cystobacter.
Sequence
MPPKKNLSKLDTELLSAIEASDTKAVASHLKAGANPNARNQEGHTALHSAAANASAEIVE
LLLEAGADVNGPASDSAIALCFATAHTGDNAVAMVKQLIARGSNVNHQWEDEARSTVLTD
LLNQENNEEPSAEILRTLLHAGADPNRPNGQNETPLMLAAGYKQQPELAELLLEHGAQVN
AVGRWGMTALMHAIQCGNAPLVERLIAKGADIHQATEDTEGNTPLTLALNLDELHGEPSA
DVLGVLLRAGANPNTPNARGWTPLHFAACLEDVKLTELLLQAGADARRPHANGNYPIDTA
SHRGHAKVVERLLAAGSPTLEQAAAERMEGIWKRIGTWYAQNHPTYAENLERTRPATPAK
VAALEEALETELPADFRAFLLRFGGGAPSDRGLSIAEYDVLSVEQILSRWKGLGKLREEG
TFADVSPHELSEDQKQVAWTWWHPGWIPFAQDGGGNLYCVDLAPGPQGERGQVIGWEMHG
GPLRPRATSLDAFFDTYLEKLTDGRIQLRDDE
Download sequence
Identical sequences A0A1L9B0C4
WP_071903291.1.39417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]