SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9QWG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9QWG8
Domain Number 1 Region: 10-212
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000587
Family Lipase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L9QWG8
Sequence length 258
Comment (tr|A0A1L9QWG8|A0A1L9QWG8_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:OJJ27014.1} KW=Complete proteome; Reference proteome OX=1925591 OS=Roseofilum reptotaenium AO1-A. GN=BI308_02865 OC=Coleofasciculaceae; Roseofilum.
Sequence
MDWLEIDENWVLVPPRPIAIVHFLGGAFIGAAPHVTYRWLLEAIATQGYIIVTTPFINTF
DHYQIARSVLEQFNQTLTQLERLGKLRRRYLPLYGLGHSMGCKLHLIIGSFPKINHAGNI
FIAYNNYPVNQSIPLGQELNLATMFQLEFTPSPEQTEVLIEKDYQIRRNLLIRFQNDNID
QSSRLIEILRARFANMVTLQRLPGNHLTPTGQDINWQAGREFSPLDAMGQWVKQEFIYKD
ITRLKAEILRWLNPGFSR
Download sequence
Identical sequences A0A1L9QWG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]