SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M7D9I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M7D9I0
Domain Number 1 Region: 190-318
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.81e-31
Family Glutathione peroxidase-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1M7D9I0
Sequence length 331
Comment (tr|A0A1M7D9I0|A0A1M7D9I0_PRERU) Peroxiredoxin {ECO:0000313|EMBL:SHL76033.1} KW=Complete proteome OX=839 OS=Prevotella ruminicola (Bacteroides ruminicola). GN=SAMN02745192_1190 OC=Prevotella.
Sequence
MKKVLFAAAIMMAAGAKAQQVNYTISGVSKDNGAKVVVIDAQARKMENATVENGKFSISG
SAEKNALLIIRNSSVSWMMPIINDGTPITVNLNDTTVTGSAQNERLVRYDIDMNAAYGKL
GVKAGLEKIYTDEVNTMIPVAFVEQYLEEFGLEKLQKTMATKPVWANHPAVQSAIKEYEF
EQADRAKKAAYIGKQFTDLEEPDTDGNMHKLSEYVGKGKWVLVDFWASWCAPCRAEMPNV
VKAYEKYHDKGFDIVGLSFDNRKEPWVKAITDLKMPWTHLSDLKGWKTVASGLYEVNSIP
DNLLIDPQGKIVARGLRAQGLQDKLKEIFGE
Download sequence
Identical sequences A0A1H0XXV9 A0A1M7D9I0 D5ERU2
WP_013064074.1.33358 WP_013064074.1.47345 WP_013064074.1.49956 WP_013064074.1.69841 WP_013064074.1.78806 gi|294673730|ref|YP_003574346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]