SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1P6BUA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1P6BUA4
Domain Number 1 Region: 63-106
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 8.5e-16
Family Transcriptional factor domain 0.01
Further Details:      
 
Weak hits

Sequence:  A0A1P6BUA4
Domain Number - Region: 5-45
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00575
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1P6BUA4
Sequence length 109
Comment (tr|A0A1P6BUA4|A0A1P6BUA4_BRUMA) DNA-directed RNA polymerase subunit {ECO:0000256|PIRNR:PIRNR005586} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=BM_Bm2231 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MLSEFCSECGTVLPIPATAPVTITCSYCRTQWHIKPIRNKLVYRSEKVYQNRVLNANEGA
LENPVVDKICDKCGHGKMSYACRQTRSADEGQTVFYMCLKCNYNMVENA
Download sequence
Identical sequences A0A0R3QFB7 A0A1P6BUA4
XP_001893050.1.25112 Bm1_07900 Bm2231 Bm2232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]