SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1P8NZB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1P8NZB9
Domain Number 1 Region: 58-183
Classification Level Classification E-value
Superfamily Virus ectodomain 7.34e-59
Family Virus ectodomain 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1P8NZB9
Sequence length 225
Comment (tr|A0A1P8NZB9|A0A1P8NZB9_9HIV1) Envelope glycoprotein {ECO:0000313|EMBL:APX54586.1} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
LYKYKVVQIEPLGVAPTKAKRRVVEREKRAAGLGALFLGFLGAAGSTMGGASXTLTVQAR
QLLSGIVQQQNNLLRAIEAQQQMLKLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKL
ICTTAVPWNSSWSNKSHDDIWNNMTWMQWEXEISNYTQEIYNLIEESQNQQEKNEKELLE
LDKWANLWTWFDITQWLWYIRIFIIIVGGLIGLRIIFAVLAIINR
Download sequence
Identical sequences A0A1P8NZB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]