SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q2YJ51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q2YJ51
Domain Number 1 Region: 238-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000783
Family UAS domain 0.035
Further Details:      
 
Domain Number 2 Region: 422-502
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000878
Family UBX domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q2YJ51
Sequence length 607
Comment (tr|A0A1Q2YJ51|A0A1Q2YJ51_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:GAV29501.1} KW=Complete proteome; Reference proteome OX=4926 OS=Pichia membranifaciens. GN=PMKS-003002 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MDNITPEEQNILDQFEEITNYDKEHESTKVLRLLTVCNWNIEVAIARYFDNDFPQLFDEV
ASQGQVPLSSVSTVGSASNMVATPAHSATGSDNIGAADNDFFRAPLLPPTTQTNFLFPFP
EDAFMPKLHRALPINNKWKFQAGLINSASNKNTYKYSRLLTPIVFLLMLMPKVLFLLGYG
LNRLFGNFAPKLFRILGLRTEEDDFPSKPAYNSDEQLSSYDVNRYIQDVSGKEVGLPIFK
GEFNAAFDEARNNFKWFCIVLFNSESSSSEKLVTDFLANDSFVKFIKNNDVILYVGDVVY
PEPFEVGQTYSAFGLPYLALIANVSPTGMTHPEFSFVCKYNKLLTGFGSTGNRIGSESSV
SRLCKKLNRLVSKYEPQLVAQRYDKQEAECSRLLREQQDNAYQESLLKDMKRQREREQKQ
NEEEEKLRREREEKLRIEEQILKRKESTIRYINEKYDRDCSGWERGDFTTIQFRTNQGQR
FIRKFIRNETALDIFKYVAGKKLIDEMINSDDNDLSTESEVLQSLKNYPYQFDQGTEQDK
VSFSFDLISPMPRLRLQPVSQQLSQIKEIWPNGSLLIEKGEDDVDDDDDDEDDEDDEDEK
EKEEEEE
Download sequence
Identical sequences A0A1Q2YJ51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]