SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3AUQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3AUQ1
Domain Number 1 Region: 4-335
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.01e-53
Family Carboxylesterase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3AUQ1
Sequence length 335
Comment (tr|A0A1Q3AUQ1|A0A1Q3AUQ1_CEPFO) Abhydrolase_3 domain-containing protein {ECO:0000313|EMBL:GAV59458.1} KW=Complete proteome; Reference proteome OX=3775 OS=Cephalotus follicularis (Albany pitcher plant). GN=CFOL_v3_02989 OC=Pentapetalae; rosids; fabids; Oxalidales; Cephalotaceae; Cephalotus.
Sequence
LVLERKLVDEVSGWLRVYDDGSVDRTWLGPSEFKFLTDPVPPHEDFIEGVATRDVTIDTN
LGLRVRIYMPDHSLDDQCKLPTLLHFHGGGFCISQADWYMYYQMYTKIARSAQAIVISVY
LRLAPENPLPAACDDGFLALLWLRSLAKGELHEPWLNDFADFNRVFLIGDSAGANLVHEV
SSRAGQVDLSPVRLAGGIPVHPGFFRSVRSNSELEQPETPLLTLVMLDKCIRMALPVGSP
EDHPIFCPMGPAVPTMDSLNIPPFLLCVAENDLFKDREMEYYQAMKKANKDVELLINPGM
GHSFYLNKIAVDMDPHTGAQTEALIEGIIKFIKRH
Download sequence
Identical sequences A0A1Q3AUQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]