SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q5Y2F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q5Y2F9
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-50
Family Ribonuclease PH domain 1-like 0.0000126
Further Details:      
 
Domain Number 2 Region: 291-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-45
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-31
Family Ribonuclease PH domain 2-like 0.00082
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.33e-28
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 619-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.22e-21
Family Cold shock DNA-binding domain-like 0.000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q5Y2F9
Sequence length 709
Comment (tr|A0A1Q5Y2F9|A0A1Q5Y2F9_HAEIF) Polynucleotide phosphorylase {ECO:0000256|HAMAP-Rule:MF_01595} KW=Complete proteome OX=727 OS=Haemophilus influenzae. GN=BLA59_08305 OC=Pasteurellaceae; Haemophilus.
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVTVVAKKDVKEGQDFFPLTV
NYQERTYAAGKIPGGFFKREGRPSEGETLIARLIDRPIRPLFPEGFFNEIQVVATVVSVN
PQISPDLVAMIGASAALTLSGVPFNGPIGAVRVGFIDNQFVLNPTMAEQKQSRLDLVVAG
TDKAVLMVESEADILTEEQMLAAVVFGHQQQQVVIEAIKEFAKEAGKPRWDWVAPQPNTD
LINKVKAIAEARLGDAYRITEKQLRYEQIDAIKADVIAQITAEDEEINEGKIVDIFTALE
SQIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVATLGTERD
AQIIDELTGERQDHFLFHYNFPPYSVGETGMIGSPKRREIGHGRLAKRGVAAVMPSLAEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEEEKFVVLSDI
LGDEDHLGDMDFKVAGTREGVTALQMDIKIEGITPEIMQIALNQAKSARMHILGVMEQAI
PAPRADISDYAPRIYTMKIDPKKIKDVIGKGGATIRSLTEETGTSIDIDDDGTVKIAAVD
SNAAKNVMGRIEEIVAEVEAGAIYKGKVTRLADFGAFVAIVGNKEGLVHISQIAEERVEK
VSDYLQVGQEVNVKVVEIDRQGRIRLTMKDLAPKQETEINQEDSVEEQE
Download sequence
Identical sequences A0A1Q5Y2F9 A5UG34
374931.CGSHiGG_03775 gi|148827370|ref|YP_001292123.1| WP_012054891.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]