SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R0X8A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R0X8A3
Domain Number 1 Region: 146-292
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.05e-23
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 26-118
Classification Level Classification E-value
Superfamily TPR-like 1.27e-17
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1R0X8A3
Sequence length 293
Comment (tr|A0A1R0X8A3|A0A1R0X8A3_9BACL) Cell wall assembly protein {ECO:0000313|EMBL:OMD30966.1} KW=Complete proteome OX=189426 OS=Paenibacillus odorifer. GN=BJP51_01055 OC=Paenibacillus.
Sequence
MSDELLAKLDEWHEEDEFQEIVDAITEIPEEERDYVLTSHLGRALNNLGQYEEALEQYLS
IEDEGEGDPLWHYRIGVSYYYLKRYDEALKAFTIADQLEPDDEDTLEFLGWIKRKLAKKA
AKKPVNKPAKKPVIALDTTNFWDDSEYAFSEYISDPPSDALITSVQEELVFKLPASYVDM
MKLHNGGIPHNNRYPIPGTGEFITISGILGIGRDKNKSLCGASGSRTVIENGRYPEVGVV
ICDCPSENEVVMLDYREFGNDGEPEVIHVDRDNKYKITRLADNFETFISGLVK
Download sequence
Identical sequences A0A1R0X8A3
WP_076124209.1.11368 WP_076124209.1.44012 WP_076124209.1.45277 WP_076124209.1.52821 WP_076124209.1.70734 WP_076124209.1.8272 WP_076124209.1.83223 WP_076124209.1.86446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]