SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1R3L500 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1R3L500
Domain Number 1 Region: 246-355
Classification Level Classification E-value
Superfamily Thioredoxin-like 7e-21
Family PDI-like 0.026
Further Details:      
 
Domain Number 2 Region: 142-182
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000195
Family PAPS reductase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1R3L500
Sequence length 358
Comment (tr|A0A1R3L500|A0A1R3L500_PRUPE) Uncharacterized protein {ECO:0000313|EMBL:ONH89482.1} KW=Complete proteome; Reference proteome OX=3760 OS=Prunus persica (Peach) (Amygdalus persica). GN=PRUPE_I005500 OC=Amygdaleae; Prunus.
Sequence
MALAVASSSTSISGRTFSPSTPSSDLKAVTFSQRRSSVKPVNAQSKRNESIVPLAATIVA
PEAVEKVEAEDITQLAKGLENASPLEIMDKALEKFGNDIAIAFRIPYLVAVVECGNCMKD
MRISLSIKSVDPVFEGLDGGIGSLVKWNPVANVEGRDIWDFLRAMNVPVNSLHSKGYISI
GCEPCTRSVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEEGNQSNGNGAAHSNGTATET
DIFTSQNLVTLSRTGIENLARLENRHEPWIVVLYAPWCQFCQAMEGSYIELADKLAGSGV
KVGKFRADGEQKEFAQNELQLGSFPTILFFPKHSSRPIKYPSEKRDIDSLMAFINALR
Download sequence
Identical sequences A0A1R3L500
ppa007707m|PACid:17647016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]